KEGG   Clostridium butyricum: ATN24_00045Help
Entry
ATN24_00045       CDS       T04197                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbut  Clostridium butyricum
Pathway
cbut00010  Glycolysis / Gluconeogenesis
cbut00030  Pentose phosphate pathway
cbut00051  Fructose and mannose metabolism
cbut00052  Galactose metabolism
cbut00680  Methane metabolism
cbut01100  Metabolic pathways
cbut01110  Biosynthesis of secondary metabolites
cbut01120  Microbial metabolism in diverse environments
cbut01130  Biosynthesis of antibiotics
cbut01200  Carbon metabolism
cbut01230  Biosynthesis of amino acids
cbut03018  RNA degradation
Module
cbut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATN24_00045
   00030 Pentose phosphate pathway
    ATN24_00045
   00051 Fructose and mannose metabolism
    ATN24_00045
   00052 Galactose metabolism
    ATN24_00045
  Energy metabolism
   00680 Methane metabolism
    ATN24_00045
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ATN24_00045
Enzymes [BR:cbut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATN24_00045
Protein phosphatases and associated proteins [BR:cbut01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ATN24_00045
Messenger RNA biogenesis [BR:cbut03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ATN24_00045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ALP88667
UniProt: A0A0A6SII6
LinkDB All DBs
Position
1:complement(10143..11099)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALNNGIEVMGVQRGYSGLINGELFSMDKTSVSDI
IQRGGTILRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFTGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRNCGDLALYA
GIAGGAESIIVPELGFDKDELCKTILEGKNKGKMHNLIILAEGIGGAFDLAKEVEEVTGI
ETRATILGHIQRGGSPSATDRVLASRMGAKAIEVLLEGKTSRVIGIRNNEIIDQDIDEAL
DMESKFDKELYNIAQVLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacaagtggtggagatgcaccaggaatgaatgctgcaatc
agagcagttgtaagaacagcacttaataacggaattgaagttatgggtgtacaaagagga
tatagtggacttataaatggagaattattcagcatggataaaacttctgtatctgatata
attcaaagaggtggaacaatcttaagaacagctagatgtcctgaatttaaaaacgaagaa
gtaagaaaaaaagctgctaaaattttacaagcctatggggttgaagctttagtagttata
ggtggagatggatcatttacaggagcaaaattattatcaaagcttggaataaagactatt
ggtcttccaggaacaatagataatgacttagcttacactgattttactttaggttttgat
acagctttaaatactgttgttgatgctataaacaaaataagagatacatcaacatctcat
gaaagagtttctattgtagaagtaatgggtagaaattgtggtgatttagctttatatgct
ggtatagcaggaggagcagaatcaatcatagtgcctgaattaggatttgataaagatgaa
ctttgtaaaacaatcttagaaggtaaaaataaaggtaaaatgcataacttaataattctt
gcagaaggaattgggggagcatttgacttagctaaggaagttgaagaagttacaggaatt
gaaacaagagcaactattttaggtcatatccaaagaggtggaagcccaagtgcaacagac
agagttttagcttcaagaatgggagcaaaagcaatagaagttctattagaaggtaaaact
tctagagtaataggaattagaaataatgaaatcatagatcaagatatagatgaagcttta
gatatggaaagcaaattcgacaaagaattatataatattgctcaagtattagcgtaa

DBGET integrated database retrieval system