KEGG   Cupriavidus basilensis: RR42_m0716Help
Entry
RR42_m0716        CDS       T03642                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbw  Cupriavidus basilensis
Brite
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RR42_m0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
main:772676..773341
Genome map
AA seq 221 aa AA seqDB search
MFAAFARVWQVPYNRQFLIFNPTERDRTMEHTLPPLPYAHDALAPHISKETLEFHHDKHH
QTYVTNLNNLIKGTEFENSTLEEIVKKSSGGIFNNAAQVWNHTFYWDSLKPNGGGQPTGA
LADAINAKFGSFDKFKEEFTKTAVGTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKP
LLTCDVWEHAYYIDYRNARPKYVEAFWNVVNWDFASKNFAG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgccgcgtttgcgcgggtatggcaagtcccctacaatcgacaattcctgatcttc
aaccccacagaaagagacagaacaatggaacatactctccccccgctgccttacgctcat
gatgcgctcgctccgcacatctccaaggagaccctggagttccaccacgacaagcaccac
cagacctacgtcactaacctgaacaacctgatcaagggcaccgagttcgaaaactcgacg
ctcgaagagatcgtcaagaagtcctccggcggcattttcaacaacgccgcgcaggtgtgg
aaccacaccttctactgggactcgctcaagcccaacggcggcggccagccgaccggcgcg
ctggctgatgccatcaacgccaagttcggctccttcgacaagttcaaggaagaattcacc
aagaccgcggtcggcaccttcggttcgggctgggcctggctggtgaagaaggccgacggt
tcgctggacctggtctcgacctccaacgccgctaccccgctgaccaccgacgccaagccg
ctgctgacctgcgacgtgtgggaacacgcttactacatcgactaccgcaatgcccgcccg
aagtatgtcgaggcattctggaacgtcgtgaactgggacttcgccagcaagaacttcgct
ggttga

DBGET integrated database retrieval system