KEGG   Cupriavidus basilensis: RR42_m3240Help
Entry
RR42_m3240        CDS       T03642                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cbw  Cupriavidus basilensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cbw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RR42_m3240
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RR42_m3240
   00680 Methane metabolism
    RR42_m3240
Enzymes [BR:cbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RR42_m3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
main:3438823..3441846
Genome map
AA seq 1007 aa AA seqDB search
MTQQAARPAGRRKPTASRADAPDTALASASIPATAPSAPSAKTTRSRRASAAKPEAAPAA
PAATPARRASDKDVPLREDIRFLGRLLGDCVREQEGESAFELVETIRQTAVRFRRENDRA
AGAELDRLLKRLSRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSLAH
ALQAIDAAGVTGKALRKFFDEALIVPVLTAHPTEVQRKSILDAEREIARLLAERDLPMTA
RERDHNTALLRARVTTLWQTRMLRNTRLMVVDEIENALSYYRTCFLRGIPQLMSELEEDI
AAVFPAARKSKAAPAASTQLAPFFQMGSWIGGDRDGNPNVTADTLQHAASQQSSLILEWY
LDEVHALGAELSMSSLMVEASPELLALAEASPDHSEHRADEPYRRALIGIYARLAATCQA
VTGQAAPRHPVADSAPYADAQSFAADVQVVIDSLRAHHGEALARTRIDALAKAIAVFGFH
LASIDMRQVSDVHEAVIAELFAAAGVEANYAGLTEARKQELLLAELRQPRLLTLPWHAYS
EQTRSELAILNMARELRGRYGARVARNYIISHTETLSDLVEVLLLQKETGMLHGTLGSKT
NPARPELMVIPLFETIEDLRNAAGIMQSLLELPGFASVIAHHGGEQEVMLGYSDSNKDGG
FLTSNWELYKAELALVQVFEARRVKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIR
LTEQGEIINSKFANAEIGRRNLETVIAATLEASLLPTQNAPKDLATFEAVMQQLSDRAFT
SYRHLVYDTPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKQRRIEDLRAIPWGFSWG
QCRLLLPGWYGFGSAVKALLDEAPDERAHKAAVATLRRMVKTWPFFTTLLSNMDMVLAKT
DLAVASRYAQLCEDAVLRKTVFARISAEWHLTCEMLALITGRQERLADNPLLARSIKNRF
AYLDPLNHLQVELLKRYRSGKDGDDIRVRRGIHLTINGVAAGLRNSG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaagctgcgcgccccgcaggccggcgcaagccaaccgccagccgggcagac
gcccccgacaccgcattggcttccgcctcgattcccgcgaccgccccatctgccccatcc
gccaagaccacccgctccaggcgcgccagcgccgcgaagcctgaggccgcgcccgccgcg
cccgccgcgaccccggcccgccgcgccagtgacaaggacgtgcccctgcgcgaagacatc
cgcttcctgggccggctgctgggcgattgcgtgcgcgagcaggaaggcgaatcggccttc
gagctggtcgagaccatccgccagaccgccgtgcgctttcgccgcgagaacgaccgcgcc
gccggcgcggagctggatcgcctgctcaagcgcctgtcgcgcgaccagaccaactcggtg
gtgcgcgccttcagctatttctcgcacctggccaatatcgccgaggaccagcaccacaac
cgccgccggcgcgtgcatgcgctggccggatcgccgccgcagccgggcagcctggcgcac
gcgctgcaggccatcgacgcggctggcgtgaccggcaaggcactacgcaaattcttcgac
gaagcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtccagcgcaagagcatt
ctcgacgccgagcgcgagatcgcccgcctgctggccgagcgcgacctgcccatgaccgcg
cgtgagcgcgatcacaacaccgcactgttgcgcgcgcgcgtcaccacgctgtggcagacc
cgcatgctgcgcaatacgcggctgatggtggtggacgaaatcgagaatgcgctgtcctac
taccgcacctgcttcctgcgcggcatcccgcaactgatgagcgagctggaagaagacatc
gccgcggtgtttcccgccgcgcgcaagagcaaggctgcgccggcggcctctacccagctc
gcgcccttcttccagatgggctcctggatcggcggcgaccgcgacggcaaccccaatgtc
accgccgacacgctgcaacacgccgcgagccagcaatcgtcgctgatcctggagtggtac
ctggacgaagtccacgcgctgggcgccgaactgtcgatgtcgagcctgatggtagaggcc
agcccggaactgctggcgctggccgaagcctcgcccgaccactccgagcatcgcgccgac
gagccgtaccgccgcgcactgatcggcatctatgcgcgcctggcggcaacctgccaggcc
gtcaccgggcaggccgcgccacgccatccggtggccgactccgcgccctatgccgacgcg
caatcctttgccgccgacgtacaggtggtgatcgactcgctgcgcgcgcaccacggcgag
gcgctggcgcgcacccgcatcgacgcgctggccaaggccatcgccgtgttcggcttccac
ctggcctcgatcgacatgcgccaggtgtccgacgtgcacgaggcggtgatcgcggaactg
ttcgccgcagccggggttgaagccaactatgccggcctgacggaagcccgcaagcaggaa
ctgctgctggccgagctgcgccagccgcgcctgctgacgctgccctggcatgcctattcc
gagcagacccgcagcgagctggccatcctgaacatggcgcgcgaactgcgcggccgctac
ggcgcacgcgtggcccgcaactacatcatctcgcacaccgagacgctgtccgacctggtc
gaagtgctgctgctgcagaaggaaaccggcatgctgcacggcacgctgggcagcaagacc
aacccagcgcgcccggaactgatggtgatcccgctgttcgagaccatcgaggacttgcgc
aacgccgccggcatcatgcaatcgctgctggagctgccgggctttgcctcggtgatcgcc
caccatggcggcgagcaggaagtgatgctgggctactccgactccaacaaggacggcggc
ttcctcacctccaactgggagctgtacaaggccgagctggcactggtgcaggtgttcgag
gcgcgccgcgtgaagctgcgtctgttccacggccgcggcggcaccgttggccgcggcggc
ggcccgacctaccaggccatcctgtcgcagccgccgggcacggtcaacgggcagatccgc
ctgaccgagcagggcgagatcatcaacagcaagttcgccaacgccgagatcggccggcgc
aacctggaaacggtgatcgccgccacgctggaagcctcgctgctgccgacgcagaacgcg
ccgaaggacctggcgacgttcgaggccgtgatgcagcaactctcggatcgcgcgttcacg
tcgtatcgccacctggtgtacgacacgcccggcttcaaggactacttcttcgccaccacg
ccgatcaccgagatcgccgacctcaacctgggttcgcgcccggcctcgcgcaagctgatg
gacaagaagcagcgccgcatcgaagacctgcgcgcgattccctggggcttttcctggggt
cagtgccgcctgctgctgccgggctggtacggctttggcagcgcggtcaaggcactgctg
gacgaggcgccggacgagcgtgcgcacaaggccgccgtggccacgctgcgccgcatggtc
aagacctggccgttcttcaccacgctgctgtccaatatggatatggtgctggccaagacc
gacctggccgtggcctcgcgctacgcgcagctgtgcgaagacgccgtgctgcgcaagacg
gtgttcgcgcgcatcagcgccgagtggcacctgacgtgcgagatgctggccctgatcact
ggccgccaggagcgcctcgccgacaatccgctgctggcgcgttccatcaagaaccgcttc
gcctacctggatccgctcaaccacttgcaggtggaattgctcaagcgctaccgctcgggc
aaggacggtgacgacatccgcgtgcggcgcggcattcacctgaccatcaacggggtggcc
gcgggcctgcgcaacagcggctga

DBGET integrated database retrieval system