KEGG   Clostridium beijerinckii ATCC 35702: Cbs_4338Help
Entry
Cbs_4338          CDS       T03415                                 

Definition
(GenBank) cytidyltransferase-like protein
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbz00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Cbs_4338
Enzymes [BR:cbz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Cbs_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(5000361..5001659)
Genome map
AA seq 432 aa AA seqDB search
MKTVYVAMSADIIHQGHLNVLNEARKFGDIIVGLHTDEVIRGYWRNPIMKYDERKEVISN
IKGVISVVPQESLDQVQNLLKIRPNYVLHGDDWKEGSQKELREKVIEVLKQWEGELIEVP
YTKGVSISKLDEELAKIGITPQMRMKGLKELIYSKKPLRILEAHNGLTGLIVEKTKVQRD
GKIKEFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTEVKQTQDTIEHFCDKIRAGREARVTSDF
MIISRIESLIAGAGMDDAIKRAKAYIEAGTDGIMIHSKEKDGREIIEFCRRYNEFENRVP
LVVVPTSYNFMKEEELMELGVNVIIYANHLIRSAYPAMVNTAKSILENGRSKEASINCMP
IKEILTLIPGGM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtttatgttgctatgagtgctgatataattcatcaaggacatttaaatgta
ctaaatgaagcaagaaaatttggagatataatagtgggattgcatacagatgaggttata
agaggttactggagaaatccaataatgaagtatgatgagagaaaagaagtgattagtaat
attaaaggagttatatctgtagttcctcaagaaagcttagatcaagttcaaaaccttctt
aaaattagacctaactatgttcttcacggggatgattggaaggaaggctcgcaaaaagaa
ttaagagaaaaagttatagaggtgttaaaacaatgggaaggagaacttatagaagttcca
tatactaaaggggtttctatttcaaaattagatgaagaattagctaaaataggtataaca
cctcaaatgagaatgaaaggtctaaaggaattaatttattcaaagaaacccctaagaata
cttgaggctcataatggcttaacaggactcattgttgaaaagactaaagttcaaagggat
gggaaaataaaagagtttgatggaatgtggattagttcattatgtgattcaacagctaag
ggaaaacctgatatagaattggtagatttaacatcaagattaaatacaattaatgatatc
ttagaggtaacaacgaaaccgataatagttgatggagatacaggaggacaaattgaacat
ttcgtttatacagttaagactttagagaggttaggagtttcagctattattattgaagat
aaaactggtcttaaaaaaaattcattatttggaacagaagtgaagcaaactcaagataca
atagaacatttttgtgacaaaataagagctgggagagaggcgagagtgactagtgatttt
atgataatttcaaggattgaaagtttaattgcaggcgctggaatggatgatgctataaaa
agggctaaagcttatattgaagcaggaacagatggtatcatgattcatagtaaagagaaa
gatggaagagaaattattgaattctgtagaagatataatgagtttgaaaatagagtacct
ttagtagtagtcccaacctcatataattttatgaaagaggaagagttaatggaattagga
gttaacgttattatttatgcaaatcatctgataagaagtgcatatccagcaatggtaaat
acagcgaaaagcattttagagaatggacgatctaaagaggcttcaatcaattgtatgcct
ataaaagaaatacttactttgattccaggaggaatgtaa

DBGET integrated database retrieval system