KEGG   Cajanus cajan (pigeon pea): 109790845Help
Entry
109790845         CDS       T04868                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109790845
Enzymes [BR:ccaj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109790845
Transporters [BR:ccaj02000]
 Other Transporters
  Pores ion channels [TC:1]
   109790845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C Usg GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 109790845
NCBI-ProteinID: XP_020205683
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MGSEEVKVVSFWASPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVH
AHKPIAESLIILEYIDETWKQYPLLPQHPYQRALVRFWTNFVEQKLFDAAWLGMCSSGDE
REKGVKVAREVMEKIEEEIKGKRFFGGENIGYLDIALGWISYWLPVWEEVGSMEIIESLK
YPATTAWINNFLTHPLIKDTFPPRDNMILYYNRRKTLFSTFNV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgaagaggtgaaggtggtgagcttttgggcgagtccatttggtaaaagggta
gagtgggctttgaaactcaagggtgtagaatatgagtacattgaagaagatatcttcaac
aagagcaatctccttctccagctgaacccggttcacaagaaggttccggttcttgttcat
gcccacaaacccattgctgagtcacttatcatccttgaatacatcgatgaaacatggaag
cagtatccactcttgcctcaacatccttatcaaagagcacttgttcgcttctggactaat
ttcgttgagcaaaagctttttgatgcagcatggcttggtatgtgttcgagcggggatgag
cgggaaaagggtgtgaaagtagcaagagaagtaatggagaaaatagaagaagagataaag
ggaaagagattctttggtggggagaatattgggtacctagatattgcacttggatggatt
tcgtactggctccctgtttgggaggaagttggatcaatggagataatagagtcattgaaa
tatccagccaccactgcatggatcaacaattttctgacccaccctctcatcaaggacacc
tttccaccaagagacaacatgattctttactacaatcgcagaaagacacttttttcaact
tttaatgtttag

DBGET integrated database retrieval system