KEGG   Cajanus cajan (pigeon pea): 109795101Help
Entry
109795101         CDS       T04868                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109795101
Chromosome [BR:ccaj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     109795101
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 428 aa AA seqDB search
IVHRCLKCGTFHFDAIHEFYQRLHFWPRELSFTDSRILFPKPLLSQVGVSVAPQFCIRFA
AVGTSPIRHHRICLRQPSSPMSSSSANDAEALMRNRILSSKLYFDVSPSKVPLIYSESYD
IAFLGIEKLHPFDSSKWGRICRFLVSFGILDKKCIVEPLEASKDDLLVVHSESYLNSLKE
SSKVAMIVEVPPVALIPNCLVQQKVLFPFRKQVGGTILAAKLAKERGWAINVGGGFHHCS
AEKGGGFCAYADISLCIHFAFVRLNISRVMIIDLDAHQGNGHEMDFSYDNRVYILDMYNP
GIYPLDYEARNYINQKVEVKSGTLTEEYLQKLDEALVVAGQRFNPELVIYNAGTDILEGD
PLGRLEISPDGIALRDEKVFRFAREKNIPIVMLTSGGYMKSSARVIADSIVNLSKKCLIE
TSGAPKST
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atagtgcaccgttgcctgaaatgtggaacattccatttcgatgccattcatgaattttat
caacggctgcatttctggcctcgtgagttaagtttcaccgattcacgaattttgttcccg
aaaccgttactgagtcaagtcggtgtttcggtggctccgcaattttgcatcaggttcgcc
gccgtcggaacatctccgattcgccaccaccgtatctgtctccgtcaaccgtcgtcaccg
atgtcgtcttcttccgcgaacgacgccgaggctctcatgcgcaaccgcatcctctccagc
aagctctacttcgacgtgtctccgtccaaggttccgcttatctactccgagtcttacgac
atagcgtttctcggcatagagaaactgcatccgtttgattcgtctaagtggggacgcatt
tgtcgattcctcgtttcgtttggcattttagacaaaaaatgcatcgttgagcctctcgaa
gcttccaaggatgatcttctagtggtacactccgaatcatatttgaatagcttgaaggag
agttcgaaagttgctatgatagttgaggtccctcccgtggcattaattcccaattgtctt
gtgcaacaaaaagttcttttcccattcaggaagcaggttggaggaactatattagctgca
aaacttgcaaaggagagaggatgggccattaatgtgggaggaggatttcatcactgctct
gcagaaaaaggaggtggattctgtgcttatgcagatatttctctgtgcatccactttgct
tttgttcggttgaatatatcaagggtgatgatcattgatcttgatgcacatcaaggaaat
ggtcatgaaatggacttttcctatgacaatcgagtctatatcttggatatgtacaatcct
ggaatatatcctttggattatgaggcgagaaactacataaatcagaaagttgaagtaaag
agtgggacacttacagaagagtacctgcaaaaattagatgaagcacttgtggttgctggg
caaagatttaaccctgagttggtaatttataatgctggaactgacatcctagaaggtgat
ccattaggaaggttggagatcagtcctgatggaattgcccttagagatgagaaagttttc
cggtttgctcgtgagaagaacattcctatcgtcatgctaacttcaggtggttacatgaag
tccagtgcaagagtcatcgcagattcaatagtcaatctttcgaagaaatgtttgatagaa
acgagtggagctccgaagtctacgtaa

DBGET integrated database retrieval system