KEGG   Castor canadensis (American beaver): 109679472Help
Entry
109679472         CDS       T04791                                 

Gene name
Pcsk2
Definition
(RefSeq) LOW QUALITY PROTEIN: neuroendocrine convertase 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ccan  Castor canadensis (American beaver)
Brite
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     109679472 (Pcsk2)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S8: subtilisin family
   109679472 (Pcsk2)
Chaperones and folding catalysts [BR:ccan03110]
 Intramolecular chaperones
  Subtilisin family
   109679472 (Pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 109679472
NCBI-ProteinID: XP_020010256
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MKGGCGSQWKAAAGLLFCVTVFASAERPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFTEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSAXWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKQELEEELDEAVERSLKSILSKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtggatcccagtggaaggcagccgccgggctcctcttctgtgtcacg
gtttttgcatctgccgagagaccagtcttcacgaatcattttcttgtggagttgcataaa
ggaggagaggaagaagctcgccaagttgcagcagagcacggctttggagtccgaaagctc
cccttcacagaaggcctgtaccacttttatcacaatggccttgcaaaggccaaaaggaga
cgaagcctacaccacaagcagcagctggagagagaccccagggtaaagatggctttgcaa
caggaaggatttgaccgaaaaaaacgaggatacagagatatcaatgagattgacatcaac
atgaacgatcctcttttcacaaagcaatggtatctgatcaataccgggcaagctgatggt
actcctgggcttgatttgaatgtggcagaagcctgggagctgggatacacaggcaaaggt
gtaaccattggaattatggatgatgggattgactatctccacccggacctggcctccaat
tataatgcagaggcaagttacgacttcagcagcaatgatccctatccctaccctcggtac
actgatgactggtttaacagccatggaacccgatgtgcaggagaagtttcagctgccgct
aacaacaatatctgtggggtcggggtagcatacaactccaaggtggcaggtatccggatg
ctggaccagccattcatgacggacatcatcgaagcctcctccatcagccacatgcctcaa
ctgattgacatctacagtgctnagtggggccctacagataacgggaagacagtggatggg
cctcgagagctcacacttcaggccatggcagatggcgtaaacaagggtcgcgggggcaaa
ggcagcatctacgtgtgggcctctggggatggtggcagctatgatgactgcaattgtgat
ggctatgcctcaagcatgtggactatctccatcaactcagccatcaacgacggcaggacc
gccctgtatgatgagagctgctcctccaccttggcatccaccttcagcaatgggaggaaa
aggaaccctgaggccggtgtggccaccacagatttgtatggcaactgcactctgaggcat
tctgggacatctgcagctgctcccgaagcagctggagtgtttgcactggctttagaggct
aatctgggtctgacctggcgagacatgcagcatctcactgtgctcacctccaaacgaaac
caacttcacgatgaggtccatcagtggcggcggaatggagttggactggagtttaatcac
ctctttggctatggggtccttgatgctggtgccatggtgaaaatggctaaagactggaaa
actgtgcctgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaatacca
tccacaggcaagttggtgttgaccctcacaacagatgcatgtgaaggaaaggaaaatttt
gtccgttacctcgagcatgtccaagctgtcatcacagtcaatgccaccaggagaggtgat
ctgaacatcaacatgacttcccctatgggcaccaagtctattttgctgagccggcgtcca
agggatgacgactccaaggtgggctttgataagtggcctttcatgaccacccacacttgg
ggggaagatgcccgaggaacctggaccctggagcttgggtttgtgggcagtgcaccccag
aaaggggtgctgaaggagtggaccctgatgctgcatggcacacagagtgctccttacatt
gaccaggtggtgagggattaccagtcgaagctggccatgtccaagaagcaagagctggag
gaagagctggatgaagctgtggagagaagcctgaaaagcatcctaagcaagaactag

DBGET integrated database retrieval system