KEGG   Castor canadensis (American beaver): 109682286Help
Entry
109682286         CDS       T04791                                 

Gene name
Tgm5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5 isoform X1
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
ccan  Castor canadensis (American beaver)
Brite
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109682286 (Tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 719 aa AA seqDB search
MAQGLEVALTDFQSSWNNVRHHTDEISVDSLLVRRGQAFNITLYFRNRGFQPGLDNIIFV
AETGPLPELAKGTRAVFSLASCGGPSPWIASLETNGATSMEVSLRAPPMAAVGRYVLKIH
ISSCQGSVTAYQLGEFILLFNPWCPGDAVFLDSEPQRLEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLHFQIDPGTDCALRGSPVYISRVVCAMINSNDDNGVLNG
NWSENYTDGVNPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNYHVWNECWMARKDLSPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTCFAFSMVNADCMSWLVHDGKEEKLYHDT
TTVGNFISTKSIQSDERDDITESYKYGEGSPQERQVFLKALQKLKTRRPQDTHRVDSRPT
RFMSPNQDSPHSLDTSPLQPSDVVQVSLKFKLLDPPNMGQDINFVLLALNMSPQFKDLKV
NLSAQSLLHDGSPLSPFWQDIVFLTLCPKEAKTYPCKIPYSQYSQFLSTDKLIRISALGE
EKSSPEKILVNKIITLTYPGITINVLGAAFVNQPLSIQVIFSNPLSEPVEDCVLTLEGSG
LFKKQQRILIGVLKPHHKATITLKTVPFKSGQRQIQANLKSNKFKDIKGYRNVYVDFGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagggttggaggtggccctcaccgacttccagagctcttggaataacgtgagg
caccacacagacgagatcagcgttgactccctccttgtccgtcggggccaggccttcaac
atcaccctttacttcaggaaccggggcttccagccaggcctggacaacatcatctttgtg
gctgagactgggcccctgccagaactggccaaaggcactcgggcagtgttcagcctggca
agctgtggtggacccagtccctggatcgcctcactggagaccaatggggccacctcaatg
gaagtgagcctgcgtgccccgcccatggcagctgtgggtcggtatgtcctgaaaattcat
atcagctcctgccaggggtctgtcacagcctaccagctcggggagttcatcctgctcttc
aatccctggtgcccaggggatgctgtcttcttggacagtgaacctcagaggctggagtat
gttgtgaatgattatggcttcatctaccaagggaacaagaactggatccgtccgtgcccc
tggaactacggacagtttgaagagaatatcatagacatctgcctggagctgctggacaag
agcctgcactttcagatcgacccaggaacggactgtgccctgcggggaagccctgtctac
atcagcagagtggtgtgcgccatgatcaacagcaacgatgacaatggggtactcaatgga
aactggagtgaaaattacacggatggtgtcaaccctgcagagtggactggcagtgtggcc
atcctgaagcagtggcatgccacaggttgccagccagtgcgctacggacagtgctgggtc
tttgctgctgtcatgtgcacagtgatgaggtgcctggggatccccactcgcgtgatcacc
aactttgactctggccatgacaccgatggaaacctgatcattgatgagtactatgacaac
acaggcaggattctggagaataagaagaaggacactgtctggaattaccatgtttggaat
gagtgctggatggctcgtaaggacctctctcctggatatggaggctggcaggtgctggac
gccacaccgcaggagaccagcaatggcctctactgttgtggccctgcctctgtcagagcc
atcaaagaaggagaagtggatctgaactacgacacatgctttgcattttctatggtgaat
gctgactgcatgtcctggctcgtccatgatggaaaagaagagaaactttaccatgacaca
actactgttggtaattttatcagcaccaagagcatccagagtgacgagcgggatgacatc
acagagagctacaagtatggagaaggttccccccaagagaggcaggtgtttctgaaggct
ctacagaagctgaagactagaaggccccaagacacacatcgagtagactcaagacccacc
aggttcatgtcaccaaaccaggacagccctcacagcctggatacatcgcctctccaacca
agcgatgttgtccaggtctccctgaaattcaagctacttgacccacccaacatgggccag
gacataaactttgtcctattggccctcaacatgtcaccccagttcaaggatctcaaagtg
aacctgagtgcccagtcccttctgcatgatggcagccccctgtccccattctggcaggac
atagtgttccttacactgtgtcctaaagaagcaaagacctacccctgcaaaatcccctat
tcccagtacagccagttcctgtcaacagacaagctaatccgtatcagcgccctgggtgaa
gaaaagagcagtcctgagaaaatcctggtgaacaagatcatcaccttgacttatccgggc
atcacgattaatgttctaggagcagcgtttgtgaaccagccactctccatccaggtgata
ttttcaaaccctctctcagagccagttgaggactgtgtgctgaccttggaaggaagtggc
ctctttaagaagcagcagagaatcctcattggagtcctcaaaccccatcacaaagccacc
atcactctgaagactgttcctttcaagagtggccaaaggcagatccaagccaatctgaag
agcaacaagtttaaggacatcaaaggttatagaaatgtatatgtagactttgggttataa

DBGET integrated database retrieval system