KEGG   Castor canadensis (American beaver): 109682405Help
Entry
109682405         CDS       T04791                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4-like
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ccan  Castor canadensis (American beaver)
Pathway
Apelin signaling pathway
Alcoholism
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    109682405
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    109682405
  Substance dependence
   05034 Alcoholism
    109682405
  Infectious diseases
   05169 Epstein-Barr virus infection
    109682405
   05165 Human papillomavirus infection
    109682405
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109682405
Chromosome [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109682405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1085 aa AA seqDB search
MKQNRKYQFAPKKNGLSGRDQPVELLNPTRVNHMPSTVDVATALPLQVAPAAVPMDLRLD
HQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQ
QQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMK
LQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYD
AKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVADSACSS
APGSGPSSPNSSSGNVSTENGIAPTVPSIPAETSLAHRLVTREGSVAPLPLYTSPSLPNI
TLGLPATGPSAGAAGQQDAERLALPTLQQRISLFPGTHLTPYLSTSPLERDGGAAHNPLL
QHMVLLEQPPTQTPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPXPQNA
QALQHLVIQQQHQQFLEKHKQQFQQQQLHLSKIIPKPSEPARQPESHPEETEEELREHQA
LLDEPFLDRLPGQKEVHTLAGVQVKQEPIESDEEEAEPVREAEPGQRPPTEQELLFRQQA
LLLEQQRIHQLRNFQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTT
GLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTV
HSEAHTLLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVV
ELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDW
DVHHGNGTQQAFYSDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLD
PPMGDTEYLAAFRMVVMPIANEFAPDMVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQ
LMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLQQRPNANAVRSMEK
VMEIHSKYWRCLQRLSSTVGHSLIEAQKCENEEAETVTAMASLSVGVKPAEKRPDEEPME
EEPPL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaacaggaaataccaatttgcaccaaagaaaaatggactttctggacgagac
cagccagtagagctgctgaatcctacccgcgtgaaccacatgcccagcacagtggacgtg
gccacagcactgcctttgcaagtggcccctgcagcagtgcccatggacctgcgcctggat
caccagttctcgctgcctgtggcggagccagcgctgcgagagcagcagctgcagcaggag
cttctggcgctgaaacagaagcagcagatccagcggcagatcctcattgctgagttccag
cggcaacatgagcagctgtcacggcagcacgaggctcaactgcatgagcacatcaagcag
cagcaggagatgctggccatgaagcaccagcaggagctgctagagcaccagcgcaaactg
gagcggcaccgccaggagcaggagctggagaagcagcaccgtgagcagaagctacagcag
ctcaagaacaaggagaagggcaaagagagtgcagtggccagcacagaggtgaagatgaag
ctgcaggagtttgtcctcaacaagaagaaggcactggcccaccggaacctaaaccactgc
atttccagcgacccccgctactggtatgggaagacacagcacagctccctggaccagagc
tcgcctccccaaagtggggtgtcagcctcctataaccatccagttctggggatgtatgat
gccaaagatgacttccctcttaggaaaacagcttctgagcccaacctgaaattgcggtcc
aggcttaagcagaaagtggctgagagacggagtagccccctgttgcgcaggaaggatggg
cctgtggtcactgctctaaaaaagcgtcccctggatgttgcagactctgcatgcagcagc
gcaccaggctccggacccagctcacccaacagcagctccggcaatgtcagcaccgaaaat
ggcattgcgcccacagtgcccagcatcccagctgagaccagcttggcgcatagacttgtg
actcgagaaggctcagttgccccacttcctctctacacgtcaccatccttgcccaatatc
accttaggacttcctgccactggtccttctgctggtgcagcaggccagcaggatgccgaa
agacttgctctcccaaccctccagcaacggatctccctgttccctggcacccacctcacc
ccatacctgagcacctcgcccctagagcgggatggcggggcagctcacaacccactgttg
cagcacatggtccttctggaacagccacctacacagacacccctcgtcacaggcctgggg
gcactgcccctccacgcacagtcgttggtcggtgcagaccgtgtgtccccatccatccac
aagctgcggcagcatcgcccactgggccgcacacagtcagcacccntgccacagaatgca
caggccctgcagcacctggtcatccagcagcagcaccagcagttcctggagaagcacaag
cagcagttccagcagcagcagctacacctcagcaagattatccccaaacctagtgagcca
gcccggcagcctgagagccaccccgaagagacagaggaggagctccgtgagcaccaggcc
ctgctggacgagcccttcctggaccggctcccagggcagaaggaggttcatacacttgct
ggtgtccaggtgaagcaggagcccattgagagtgacgaggaggaggcagagcctgtgcga
gaagcagagccaggccagcgtccgcccacagagcaggaactgctcttcagacagcaagcc
ctcttgctggagcagcagcggatccaccagctgaggaacttccaggcatccatggaggct
gcgggcatccctgtgtcattcggtggccacaggcctctgtctcgggcacagtcatcccca
gcatccgccacgttccccatgtcggttcaggaaccccccaccaagccaaggttcaccaca
ggccttgtgtacgacacactgatgctgaagcaccagtgcacctgtgggaacaccaacagc
caccctgagcacgctgggagaatccagagcatctggtcccgcctgcaggagactggcctc
cgtggcaagtgcgagtgcatccgcggacggaaggccacgctggaggagctgcagacagta
cactcggaagctcacacactcctctatggcacaaaccccctcaataggcagaaactggac
agctcactgacttcggtgtttgtcaggcttccttgtggtggtgttggggtggacagcgac
accatatggaacgaggtgcactcatcaggggcagcccgcctagccgtgggctgcgtggtg
gagctggtctttaaggtggccacaggggagctgaagaatggctttgcagtggtccgcccc
ccaggacaccacgctgaggagagcacccccatggggttttgctacttcaattctgtggcg
gttgcagccaagcttctccagcagaggctgaacgtgagcaagattctcattgtggactgg
gatgtacatcatgggaatgggacccagcaggctttctacagtgaccccaatgtcctttac
atgtccctgcatcgctacgacgacgggaacttcttcccaggcagtggggcacctgatgag
gtgggcacaggtccaggcgtgggcttcaatgtcaacatggctttcacaggtggcctcgac
ccccccatgggagacactgagtacttggcagccttcagaatggtagtcatgccaatcgcc
aatgagtttgccccagacatggtgctggtgtcgtcaggctttgatgctgtggagggccac
cccacaccccttggagggtacaacctgtctgccaaatgttttgggtacctgacaaagcaa
ctgatgggcctggctggcggccggattgtgctggctcttgagggaggtcacgacctgaca
gccatctgtgatgcctccgaagcatgcgtttctgctctgctgggaaacgagcttgagcct
ctgccagaaaaggttttacagcaaagacccaatgccaatgctgtccgctccatggaaaaa
gtcatggaaatccacagcaagtactggcgctgcctgcagcgcttgtcctccacagtgggg
cattctctgatcgaggcgcagaagtgtgagaatgaggaagctgagacagtcaccgccatg
gcctcgctgtcagtgggcgtgaagcccgccgagaagaggccagacgaggagcccatggaa
gaagaaccaccactgtag

DBGET integrated database retrieval system