KEGG   Castor canadensis (American beaver): 109682464Help
Entry
109682464         CDS       T04791                                 

Gene name
Neu4
Definition
(RefSeq) sialidase-4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
ccan  Castor canadensis (American beaver)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    109682464 (Neu4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    109682464 (Neu4)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     109682464 (Neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 480 aa AA seqDB search
MGAPRVPGRTVLFQRERTGLTYRVPALLPVPPGPTLLAFAEQRLSPDDSHAHRLVLRRGT
LAGGSLRWGALRVLGTAALEEHRSMNPCPVLDAGSGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVTSRDAGLTWGSARDLTEEAIGPAVQNWATFAVGPGHGVQLRSGRLLVPAYTYR
VDRRECFGKICWTSPHSFTFYSDDHGHTWHCGGLVPNLRSGECQLAAVDGGFLYCNARSP
LGNRVQALSTDGGTSFLPGELVPSLAETARGCQGSIVGFPAPVPSRPQDKGWSLGTRNTP
CPPLLCPGVQEFPGEGVGGTCGGWVPRGPFCHPQPWGDGSEQPGWEPGLGEDRRALVPVL
PMRCAALPQSSTWLLYSHPAGRRARLDMGIYLSRSPLDPHSWTDPWVIYEGPSGYSDLAS
LGPVSGATLAFACLFESGARAAYDDISFCMFSLRDVLENVPTGSELPSHRDKPWGRCRPS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggagccccgcgtgttcctgggcgcacggtgctcttccagcgggagaggacagggctg
acctaccgcgtgccggcgttgctccctgtgccccctgggcccaccttgctggcctttgcg
gagcagcggctcagccccgacgactcccacgcccatcgcctggtgctgaggaggggcacg
ctggccgggggctccctgcggtggggcgccctgcgcgtgctggggaccgccgccctggag
gagcaccggtccatgaacccctgccccgtgctggacgcgggctcgggcaccgtcttcctc
ttcttcatcgccgtgctgggtcacacgcccgaggccgtgcagattgccaccggcaggaat
gcggctcggctctgctgcgtgaccagccgcgacgcgggcctcacctggggcagcgcccgc
gacctcacggaggaggccataggcccagctgtgcagaactgggccacctttgcagtgggt
ccaggccatggggtccagctgcgctcaggtcgcctgttggtgccagcttatacctaccgt
gtggaccgtcgggagtgttttggcaagatttgctggaccagcccacactccttcaccttc
tacagtgatgaccatggccacacctggcactgtggaggccttgtgcccaacctgcgctcg
ggtgagtgccagctggctgcggtggatggtggcttcctctactgcaatgcccggagcccc
ctgggcaaccgtgtacaggctctcagcaccgatgggggcacctccttcttgcctggggag
cttgtgccctccctggccgagactgcccggggctgccagggcagcattgtgggcttccca
gccccagtccccagcaggcctcaggataagggatggtcattgggcaccaggaacacccct
tgccctccgctcctctgtcctggagttcaggaattcccaggggagggtgttgggggcact
tgcgggggttgggtgcctagagggcccttctgccacccacagccctggggggatggctca
gagcagcctggctgggagcctgggctaggtgaggacaggagagccttggtcccagtgctc
cccatgcgctgtgccgccctacctcagagctccacgtggctgctgtattcccacccagcg
gggcgcagagctcggctagacatgggaatctacctgagccggtcccccctggacccgcac
agttggacagatccttgggtgatctatgagggccccagcggctattccgacctggcgtcc
cttgggcctgtgtccggggcaaccctggcctttgcctgtctgtttgagagcggggctagg
gccgcctatgatgacatctccttctgcatgttctccctgcgtgatgtcctggagaacgtg
cccacaggctccgagctgcccagtcacagggacaagccctgggggcgctgccggccctcc
tga

DBGET integrated database retrieval system