KEGG   Castor canadensis (American beaver): 109682842Help
Entry
109682842         CDS       T04791                                 

Gene name
Setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109682842 (Setd1a)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109682842 (Setd1a)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109682842 (Setd1a)
   HMT complexes
    COMPASS/SET1 complex
     109682842 (Setd1a)
    COMPASS/SET1 complex (yeast)
     109682842 (Setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Topoisom_I_N
Motif
Other DBs
NCBI-GeneID: 109682842
NCBI-ProteinID: XP_020013944
LinkDB All DBs
Position
Unknown
AA seq 1705 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATDTTESRRRSSSDTAAYTAGTAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTASTAISATTAATTASSTSSSSLSASSSSSSSSTSQFRA
SDPSYPAYYESWNRYQRHTSYPPRRATREEPPGTPFAENTTERFPPSYTTYLPPEPTRPT
DQDYRPPASEAPPPEPPEPGGGGGGGGGGASPEREEARTSPRPASPARSGSPAPETTNES
VPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSAGPGARDTGSEVPAGSGHGPC
TPPPAPASFEDVVPTGSGEPGAARESPKANGQNQASPCSSGEDMEISDDDRGGSPPPAPT
PPQQPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFV
NSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPP
PQEAAYGLPYALYTQGQEGRGTYSREAYHLPLPMAAEPLPSSSVLGEEARLPPREEAELA
EGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA
AKQQAKEEDKEKTKLKEPGMLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEP
SEISEASEEKRPRPSTPAEEDEDDPEREKDAGEPGRPGTKPPKRDEERGKTQGKHRKSFA
LDSEGEEASQESSSDKDEEEEEEDEEDEEREETVDTTKKEAEASDGEDEESDSSSKCSLY
ADSDGENGSTSDTESSSSSSSSSSSSSSSSSSSSSSSSDSSSEEEEEQPAIIPSASSPPR
EAPAPLPAPAEEPEPERVASSPVTPLPEQGTSPARPAGPTEEPPPSVPQPPSEPPAGPPA
PTSRPDERPSSPIPLLPPPKKRRKTVSFSAVEEVPAPEPPPTVPPQAKSPGPISRKVPRG
VERTIRNLPLDHASLVKSWPEEVSRGSRSRAGGRGRPTEEEEAEPGTEVDLAVLADLALT
PARRGLVTLPPGDDSEATETSDEAERSSPLLSHILLEHNYALAVKPTPATPAPRPPEPVP
APAALFSSPADEVLEAPEVVVAEAEEPKQQPQLQQQPEEGEEEEEEEEESESSESSSSSS
SDGEGAIRRRSLRSHTRRRRPPLPPPPPPPPSFEPRSEFEQMTILYDIWNSGLDLEDMSY
LRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSARSEGYYPI
SKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKLNQ
LKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSS
YLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITY
DYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5118 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggaaggtgggggagatgggcagaaagccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccctgcgcaggccttctcaaaaggtgtac
cgctacgacggcgtccacttcagcgtcaacgactcaaagtacataccagtcgaagacctc
caagacccccgttgccatgtcaggtctaaaaacagagacttttccctcccagtccctaag
ttcaagctggatgagttctatattggacagatcccactgaaggaagtgactttcgcaaga
ctgaatgacaatgtgcgggaaaccttcctgaaggatatgtgccgaaagtatggtgaggtg
gaagaagtggagatccttcttcaccctcgtactcgtaaacacctgggcctggcccgtgtg
ctcttcaccagcactcggggtgccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccacgcccagcttgacatcaaaggacaacagcgaatgaagtactat
gaattgattgttaatggctcctataccccccaaactgtgcccactgggggcaaagcccta
agcgagaagttccagggctctggtgcagcaactgatacgactgaatcccgccgccgctct
tcttctgacacagctgcctacacagcaggcactgctgtagtgggcactcctggcaatggc
accccctgctcccaggacacaagcttctccagcagccgacaagataccccatcttccttt
ggacaattcacccctcagtcctcccagggaaccccctacacatctcggggcagcacccct
tactctcaggattccgcctactccagcagcaccacttcaacctctttcaagccccggcgg
tcagagaacagctaccaggattccttttctcgccgccatttctctgcatcttctgccccc
acaactgcctctacagccatctcagcaaccactgcagccaccactgcatcctccacctct
tcctcctcattgtccgcatcttcttcatcgtcgtcctcctcaacatcacaatttcgtgct
tctgacccaagctacccagcatattatgaaagctggaaccgctaccaacgccacacttcc
tacccaccacgtcgagcaactcgggaggagccccctgggaccccttttgctgaaaataca
actgaacgctttccaccttcatacaccacctacttgccccctgagcccacccggcccact
gaccaagactaccggcctcctgcctcagaggccccgcccccggaacctccagaacctggt
ggaggtggaggtggaggtggaggtggggccagccctgaaagagaagaagctcggacctcc
ccccgcccagcctcacctgcccgttctggctctccggccccagagaccaccaatgagagt
gtgccctttgcacagcacagcagcctggattctcgcattgaaatgctgctgaaggagcag
cgctccaaattttctttcttggcctctgacacagaggaagaggaagagaacagcagtgca
ggccctggggctagagacactgggagtgaggtgcctgctgggtcaggtcatgggccctgc
acaccccctccagccccagctagttttgaggatgtggtacctacagggagtggagaacca
ggggctgcccgggaatctcccaaggccaacggacagaaccaggcttctccatgctcttct
ggagaggacatggagatctccgatgatgacaggggtggctcaccacctccggccccaaca
cccccccagcagcctccgcctcccccacctccccctcctccacctccctacctggcttcc
cttccccttggttatcctccccaccaacctgcctacctcctcccaccccgccctgacggc
ccaccgccccctgagtatcccccacctccgccaccccccccccacatctatgactttgtg
aactccttggaacttatggatcgacttggagctcagtggggagggatgcccatgtccttc
cagatgcagacccagatgttaactcgactccaccagctgcgacagggcaagggattgact
gctgcctcagctggccctcctggtggggcctttggggaggccttcctccctttcccaccc
ccccaagaggcagcctatggcttgccctatgctctgtatacacaagggcaagaaggccgt
gggacatactcacgggaggcctaccatctgcctttgcctatggcagccgagcccctaccc
tcttcctcagtcttgggagaagaggcccggctgcctcccagggaagaagcagagctggca
gagggcaaggcccttccttcagctggcactgtgggccgtgtgctggccactctagtccaa
gagatgaaaagtatcatgcagcgagatctcaaccgcaaaatggtggagaatgtggccttt
ggagcctttgaccagtggtgggagagcaaggaggaaaaggctaagccattccagaatgca
gccaaacagcaagccaaggaagaggataaagagaagacaaagctcaaagagccgggtatg
ctgtccctcgtagactgggccaagagtggaggtaccacaggaattgaggcctttgccttt
ggatcagggctacgaggggccctgcggctgccttcattcaaggtaaagcggaaagagcca
tcagaaatttcagaggccagcgaggaaaagaggccccggccctccactccagctgaggaa
gatgaagatgatcctgaacgagagaaggatgctggagaaccaggacgtccggggaccaaa
cccccaaagcgagatgaagagcgaggcaagacccaaggcaagcaccggaagtcctttgct
ctggacagtgaaggggaggaggcctcccaggagtcttcctcagacaaggatgaggaggag
gaggaggaagatgaagaagatgaagagcgagaagaaactgtggataccaccaaaaaagag
gcagaggcatcagatggcgaggatgaggaaagcgattcgtcctccaaatgttctctgtat
gctgactcagatggtgaaaatggtagcacatcggacaccgagagcagcagctcctccagc
tcctcgtcatcctcatcttcctcctcatcgtcctcatcatcctcttcatcatctgactcc
tcctctgaagaggaagaggagcagccagcaatcattccctcagcttcgtcaccccctaga
gaagccccggcacccctcccagcacctgcggaggagcctgaaccagagagggtagcaagc
tccccagtcacgcctctccctgagcaagggacttctccagcaaggcctgcaggtcccact
gaagaaccacctcccagtgtgccacagcctccctcagagcccccagctgggcctccagcc
cctacttcccgcccagatgagcgcccttcttctcccattccccttctacccccacccaag
aagcgaaggaaaaccgtctccttttctgctgtagaggaggtgccagccccagagcctccc
ccaactgtcccgcctcaggccaagtctcctggcccaatctctcgcaaagtcccccggggt
gtagagcggaccattcgcaacctgcccctggaccatgcatctctggtcaagagttggcct
gaggaggtatcccgggggagtcggagccgagctggaggccgaggccgccccacagaagaa
gaagaggctgagccagggacagaagtcgacctggcagtactggctgacctggctctgacc
ccagcccggcgcgggctagttaccttgcctcctggtgatgactcagaggccacggagacc
tccgatgaggcagagcgctccagtcccctgctcagtcacatcctcctggaacacaactat
gccctggccgtcaaacccacacctgccactccagccccccggcctccagaaccagttcct
gcccctgctgcactcttcagctccccagcggatgaagtcctggaggcccctgaggtggta
gtggctgaggcagaagagccaaagcagcagccacaactacaacagcagccagaggaggga
gaggaggaggaggaggaagaggaggagtcagaatcttctgagagcagcagcagcagcagc
agtgacggggaaggagccatccggcggcgcagcctccgctcccacacccggcgccggcgg
ccaccgcttcccccccctcctcccccacccccctcctttgagccccgcagcgagtttgaa
cagatgaccattttatatgacatttggaactcgggcctggacttggaagacatgagctac
ctgcggctcacttatgagcggctgctgcagcagaccagtggggctgactggcttaatgac
acccactgggtccatcacacaatcaccaacctgagcactccaaagcgcaagcggcggccc
caggatgggccccgagagcaccaaacaggctcagcgcgcagtgaaggctattaccccatc
agcaagaaggagaaggacaagtacctggacgtgtgccccgtctcagcccggcagctggaa
ggcgtggacactcaggggactaaccgtgtgctttcggagcgccggtctgaacagcggcgt
ctgctgagcgctattggcacctctgccattatggacagtgatctgctaaagctaaaccag
ctcaagttccggaagaagaagcttagatttggccggagccggatccatgagtggggtttg
tttgccatggagcccattgcagctgatgagatggtcatcgaatatgtaggccagaacatc
cgccagatggtggctgacatgcgggagaagcgctatgtgcaggagggcattggcagcagc
tacctgttccgggtggatcacgataccatcattgatgccaccaagtgcggcaacctggcc
aggttcatcaaccactgctgcacgcctaactgctacgccaaggtgatcaccatcgagtcg
cagaagaagattgtaatttactccaagcagcccatcggagtggacgaggagatcacttat
gactacaagttcccgctggaggacaacaagatcccgtgtctgtgcggcactgaaagctgc
cgtggctccctcaactga

DBGET integrated database retrieval system