KEGG   Castor canadensis (American beaver): 109684938Help
Entry
109684938         CDS       T04791                                 

Gene name
Hkdc1
Definition
(RefSeq) LOW QUALITY PROTEIN: putative hexokinase HKDC1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109684938 (Hkdc1)
   00051 Fructose and mannose metabolism
    109684938 (Hkdc1)
   00052 Galactose metabolism
    109684938 (Hkdc1)
   00500 Starch and sucrose metabolism
    109684938 (Hkdc1)
   00520 Amino sugar and nucleotide sugar metabolism
    109684938 (Hkdc1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109684938 (Hkdc1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    109684938 (Hkdc1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109684938 (Hkdc1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    109684938 (Hkdc1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    109684938 (Hkdc1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109684938 (Hkdc1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109684938 (Hkdc1)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109684938 (Hkdc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MFAVHLLAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGTENGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGVELFDYVADCLADFMKNKELKHKKLPLGFTFSFPCRQTKLEEGFLLSWTKKFKARGV
QDTDVVSRLASAMKKHKDLDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YMGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETQHVAAMEKSKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLTRLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
REQLDGVQHKMRAELEYGLKRKTHALATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRKSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQTSIDRGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNVCYMEEMRNIELVEGDEGXMCINTEWGGFGDNDCIDDI
RTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
XEKRREDQGLEHLKITVGVDGTLYKLHPHFSRVLQETVKELAPRCDVGFMLSEDGSGKGA
ALITAVAKRLQQPRKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtgcacttgctggcgttttacttcactaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgaggctctctgatgagacccttttggacatcatg
gcgcggttccaggctgagatggagaagggcctggggaaggacaccaaccccacggcctca
gtgaagatgctgcccacctttgtcagggccattccagatgggacagaaaatggagagttc
ctttctctggatcttggaggatccaagtttcgagtcctcaaggtgcaagtctctgaagag
gggaagcgaaatgtccagatggagagtcagttctacccaacacccaatgaaatcatccgg
gggaatggcgtggagctgtttgactatgtagctgactgcctggcagattttatgaagaac
aaagagttgaagcataagaaattgccccttggctttaccttttcttttccctgcagacag
acaaagttggaagagggtttcctgctttcctggaccaagaagttcaaggcacggggagtt
caggacactgatgtagtgagccgcctggccagtgccatgaaaaaacacaaggacctggac
gtggatatcctggctttggtcaatgacactgtggggaccatgatgacctgtgcctatgat
gatccctactgtgaagttggtgtcatcattgggaccggcaccaatgcatgttacatggag
gacatgagcaacatcgaccttgtggaaggtgacgaggggaggatgtgcatcaacacggag
tggggggccttcggggatgatggggccttggaggacatccgcaccgagtttgatagggaa
ctggacctcggctcgctcaatccagggaagcaactgtttgagaagatgatcagtggcctg
tatatgggggagctcgttagactcatcttgctgaagatggccaaggctggtctcctgttt
ggcggtgagaaatcctctgctcttcacacgaagggcaagatcgaaacacagcatgtggct
gccatggagaagtctaaagaaggccttgctaacaccagagagatcctggtggatctaggc
ctggaaccctccgaggctgactgcattgctgtccagcacgtctgcaccattgtctctttc
cgctctgccaatctctgtgcggctgccctggcggccatcctgacacgtctccgggagaac
aagaagctgacacggctccggaccacagtgggcatggatggcaccctttacaagatacac
cctcagtacccaaaacgcctacacaaggtagtgagaaaactggtcccaaactgtgatgtc
cgcttcctcctgtcagagagtggcagcaccaagggagctgccatggtgactgcagtggct
tcacgtgtgcaggcccagcgtaaacagattgacaaggtgctggctttgttccagctgacc
cgagagcaacttgatggtgtgcagcacaagatgcgggctgagctcgaatatgggctgaag
aggaagacccatgcactggccacagtcaagatgctgcccacctatgtctgtgggatgcct
gatggcacagaaaaaggaaagtttcttgccctggatttggggggaactaacttccgggtc
ctcctggtgaagatcagaagtgggcggaagtcggtgcgaatgtacaataagatctttgcc
atccccttggagatcatgcagggcactggcgaggagctttttgaccacatcgtgcagtgc
attgctgacttcctggactacatgggcctcaagggagcccagctacctttgggcttcaca
ttctcctttccctgcaggcagacgagcattgacaggggaacactcgtagggtggaccaaa
ggcttcaaggctaccgactgtgaaggagaggacgtggtggacatgctcagagaagccatc
aagaggagaaatgagtttgacctggacatagttgcagtggtgaatgacacagtgggaacc
atgatgacctgtggctatgaagatcctaattgtgagattggcttgattgcagggacagga
agcaacgtgtgctacatggaggagatgaggaacatcgagctggtggaaggggatgaagga
nagatgtgtatcaacacagagtggggaggatttggggacaatgactgcatagatgacatt
aggacccagtatgacaaggaggtggacgaagggtccttgaatcctggcaagcagagatat
gagaaaatgaccagtgggatgtacctgggggagattgtgcgacagatcctcatcgacctg
accaagcagggtcttctcttccgagggcagatttcagagcgtctccggaccaggggcatc
tttgaaaccaaattcctgtcccaaattgaaagcgaccggctggccctcctgcaggtcagg
aggatcctgcagcagctgggtctggacagcacatgtgaagacagcatcgtggtgaaggaa
gtgtgtggagctgtgtctcggcgggccgcccagctctgtggtgcaggtctggctgccatc
ngtgagaaaaggagggaagaccaagggctggagcacctgaagatcactgtgggtgtggat
ggcaccctgtacaagctgcacccacacttttctcgggtactgcaggagacagtgaaagaa
ctagcccctcggtgtgatgtggggttcatgctgtcagaagatggcagcggaaagggagca
gctctgatcacggctgtggccaagaggttacagcaaccacggaaggaaaactag

DBGET integrated database retrieval system