KEGG   Castor canadensis (American beaver): 109685845Help
Entry
109685845         CDS       T04791                                 

Gene name
Tgm1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ccan  Castor canadensis (American beaver)
Brite
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109685845 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 806 aa AA seqDB search
MDGPRSDVGRWGGNSWQPPTTPEPEPEPEPDRRSRGGGSRSFWARCCGCCSRRNRADDDW
GPEPSGPRSRGSDSRGVRRPESRGTGVNAAGDGTIREGMLVVTGVDLLSSRSDQNRREHH
TDEFEYDELILRRGQPFHVVLFLNRDYESSDHITLELFIGNNPEVGKGTHVIIPVGKGGS
GGWKAQVTKASEHNLDLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPFDPRNEIYILFNPW
CPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGM
PYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGY
SVPYGQCWVFAGVTTTVLRCLGLATRTITNFNSAHDTDTSLTMDIYFDENMKPLEHLNHD
SVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYD
TPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITHLYKHPEGS
AAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLTVSVVLTNRGSSRRTV
KLHLYLSVTFYTGVTGAIFKETKKEVALAPGASDRVTMPVAYNEYRPHLVDQGAMLLNIS
GHVKESGQVLAKQHTFRVRTPDLSLTLLGAAVVGQECEVQIVFKNPLPITLTNVVFRLEG
SGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAS
GSRGFSEAGGDSRSGEAIPMASRGGA
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggatggtcctcgctcagacgtgggccgctggggtgggaattcctggcagccccctacc
acacctgagccagagccagagccagagccagacagacgctcccgcggaggaggaagccgg
tccttctgggctcgctgctgtggctgctgctcacgcaggaatagggcagatgatgactgg
ggacctgagccctctggccctagaagtcgagggtctgactctcgtggggtccgaagacct
gagtcccggggcactggtgtaaatgcagctggagatggtaccatccgagagggcatgctg
gtggtgactggcgtggatttgctgagctcacgctcagaccagaatcgccgagagcaccac
acagacgagtttgagtacgatgagctgattttgcgccgtgggcagcctttccatgtggtc
ctcttcctgaatcgggattatgagtcctctgatcacatcacccttgagctgttcatcgga
aacaaccctgaggtgggcaagggcacccacgtgatcatcccagtgggcaaggggggaagt
gggggctggaaggcccaggtgaccaaggccagtgagcataatctggacctgcgggtccac
acttcccccaacgctatcatcggcaagtttcagttcactgtgcgcacacgttcagaagct
ggggagttccagttgccctttgacccccgcaacgagatctacatcctcttcaatccctgg
tgcccagaggacattgtgtacgtggaccatgaggactggcggcaggaatatgtgcttaat
gagtctgggagaatttactatggaactgaagcacagattggcgagcggacctggaactat
ggtcagtttgaccatggggtcctggatgcctgcctgtacatccttgaccggcggggcatg
ccatatggaggccgtggggacccagtcagtgtgtcccgggtcatctctgccatggtgaac
tccctggatgacaatggagtcctgattgggaactggtctggcgattactctcgaggcacc
aacccctcagcatgggtgggcagcgtggagatcctgcttagttacctacgcactggctat
tccgttccctatggccagtgctgggtctttgctggtgtgaccaccacagtgttacgatgc
ctgggtctggccacgcgtaccatcaccaacttcaactccgcacatgacacagacacatcc
ctcactatggacatctactttgatgagaacatgaagccacttgagcatctgaaccatgat
tctgtttggaacttccatgtatggaatgactgctggatgaagaggccagacctgccctca
ggctttgatgggtggcaggttgtggacgccacaccccaggagaccagcagtggcatcttc
tgctgtggcccctgctctgtggagtccatcaagaatggcttagtctacatgaagtatgac
acacccttcatttttgctgaggtgaacagtgacaaggtatactggcaacggcaagatgat
ggcagcttcaagattgtgtatgtggaggaaaaagctatcggcacactcatcgtcacaaag
gcaatcagctccaacatgcgggaggacatcacccacctctataagcatccggaaggctca
gcagcagagcggaaggcagtggagacagcagctgcccacggcagcaaacccaatgtgtat
gccacccgggactctgctgaggacgtggccatgcaggtagaggcacaggacgccgtgatg
gggcaagatctgacggtctctgtcgtgctgaccaatcgtggaagcagtcgtcgcactgtg
aagctgcacctctacctctctgtcactttttacactggtgtcactggggccatcttcaag
gagactaagaaggaagtagcactggcaccaggagcctcggaccgtgtgaccatgcctgtg
gcctataacgaataccggccccaccttgtggaccaaggggccatgctgcttaacatttca
ggccatgttaaggagagcgggcaggtactagccaagcagcacaccttccgtgtgcgtact
ccggacctctccctcacgttactgggagcagcagtggttggccaggagtgtgaagtacag
atcgtcttcaagaaccctctgcctatcaccctcaccaacgtcgtcttccggctcgaaggc
tctgggttacagagacccaaggtcctcaatgttggggacatcgggggcaatgagacagtg
acactacgccagacttttgtgcctgtgcggccaggcccccgtcagctcattgccagcttg
gacagccctcagctctctcaggtgcatggtgtcatccaggtggatgtggccccagcctcc
gggagcagaggtttctcagaagctggaggtgacagtcgctctggggaggccatccctatg
gcatctcgaggtggagcttaa

DBGET integrated database retrieval system