KEGG   Castor canadensis (American beaver): 109689470Help
Entry
109689470         CDS       T04791                                 

Gene name
Setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109689470 (Setd2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109689470 (Setd2)
Chromosome [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109689470 (Setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2552 aa AA seqDB search
MKQLRPQPPPKMDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKVASSRFLPKGTKTK
VNLEEQGRQKVSFSFSLTKKTLQNRFLTALGSEKQNDTPNSPAIPLQVDSPKIKMDIGDT
LSTTEESSPPKSRVELGKIHFKKHLLHVTSRPQLATTISVVSPSPPTVQIPAVIAESTID
SPPSSPPPPPPPPQVTTPSPPAPITEPVALPHTPVTVLTAPVSLPVDVAVRPLKEPPLTV
VPESLEVDPKQVTVSNSSEEHITQNLKEQADTPPQKENSHIGKAEEILDSSKISLSSKKT
GSKKKSSQFEGTFLGSESDDDSVRTSSSQRSHELKFSSIEKERDFKKNSAPLKSEDLGKS
SRSKPERDDKYFSYSKLERDTRYVSSRCRSERERRRSRSRSRTDRGSRTSLSYSRSERSH
YYESDRRYHRSSPYRERTRYSRPYIDNRARESSDSEDEYKKTYSRRNSSHSSSYRDLRTS
SSYSKSDRECKTESSYLEAERRGKYSSKLERESKRTSEHEAIKRCSPPSDLGFRRGSSYS
KHDNSVSRHKSALSKHISKSDKFKNSFCCTELNEESRQSHSFGLQTPCSKGSELRTNSKI
PEREKTGSPSPSDQLNDSPTFKKLDESPIFKSEFIGHDSHDSIKELDSSSKVKKDELKSF
CPIELNINGSPGAGSDVAAFCTSKTDAVFMTSDDSVTGSEVSPLVKTCMLSSNGFQNTSR
CKEKDLDDSKSKSPFRETEPLVSPHLDKLMSLSVTTIDYSKTVVKESVDKRVPCYKTKDS
DRYCTANESNSSSCYEAENIDPSVMKISSNSFMNMHLESKTVKCDNRNLTDQHSKFACEE
FKQNVGCTSSACINHFDDLHEPIESSGTASSLQNFPSGIKVDSLTLLQCDEDTSPVLDAV
LKSKISTEFLKHAGKETREIDSALPDSRKGFASWENRHNNGLSGKCLQEAQEEGNSVLSD
RRRPEISLDEEGGRGHVHTSDDSEVVFSSYDLNLTMEDNDSVPYTLKCDSSGHAPEIVST
VHEDYSGSSESSSDESDSEDTESDDSSVPRNRLQSIVVVPKNSTLPMEETSPCSSRSSQS
YRHYSDHWEDERVESRRHSYEEKFENMASKGCLQTEKFFLHKGTEKNPEFSFVQFNRKQV
EKHLPDIAHPQSDGVDSTSHTDVKSDPLGHLNSEDTVKAKMSRQQEELPVYSSDDFEDVP
SKSRQQITFPNRPDSRLGKMELNFSSVCDISRMDGLHSSEELRNLGWDFSQQERPTSTYQ
QPDSSYGACGTHKYQQSTEQYGGTRNYWQGNGYWDPRSAGRPPGTGVAYERIQGQVPDSL
TDDREEEENWNQRGGSHFLSQSNKYLLSLQKDKGSVQAPEISSNSIKDSLAASERKEFSK
NFEKNDIKDRGPPKKRRQELESDSESDGELQDRKKVRVEVEQEETSVPPHSELIGPSCVM
DDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQ
GEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLP
SNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSC
EPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
ENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQK
LTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPT
KNMLEESKVLPIIQRWSQTKTSVPPLSEGDGYSSENTSRAHTPLNTPDPSTKLTTEVDTD
TPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENITVEEEEELQSQQLLPQ
QLPESKVESETTIEASKLPSELEADIEIEPKDNNGTKLEETIAEETPSQDEEEGVSDVES
ERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKESTITERGRDAVAFRDQTA
APKTPNRSRERDPDKQTQNKEKRKRRGSVSPPPSAYERGTKRPDDRYDTPTSKKKVRIKD
RNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNASHHPFAGYPPGYP
MQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTETLGAPPPVPVVPHVAAP
VEVSSSQYVTQSDGVVHQDSSVAVMPVPAPGPVQGQNYSVWDSNQQSVNVQQQYSPAQSQ
ATIYYQGQTCPTVYGVTSPYSQTAPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPTAAV
TAIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVIT
RQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKE
VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLEC
NENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgcggccgcagccgcctccaaaaatggatttctacgaccctgagcacccg
acccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttcatc
aaaggaccaatgttcaaagttgcttctagtcggtttttgcccaaaggcacgaagacaaaa
gtaaatttggaggaacagggacgacagaaggtgtcattcagcttcagccttacaaagaag
actttgcagaataggtttctcactgcacttggcagtgaaaaacaaaatgatactccaaac
tccccagctatacctcttcaagtagactcccctaaaattaaaatggacattggggatacc
ttatctactacagaagaatcttccccaccaaaatcaagagtggaattgggcaaaattcat
tttaagaaacatctgcttcatgtaacatccaggccacagctggctactaccatatcagta
gtatctccatctcctcctacagtacagataccagcagtcatagcagaatcaactatagac
tcaccaccttcatctccacctccaccacctccacctcctcaagtcacaacaccctcacca
ccagcaccaataacagagcctgtggccttgccacacacaccagtaacagttctgacagca
ccagtatccttaccagtagatgtagcagttagacctctgaaagaaccaccacttacagtt
gtaccagaatctttagaagtagatcctaagcaggttactgtatctaatagttcagaagaa
cacataactcaaaatttgaaggaacaagcggatactcccccgcaaaaagaaaattcccat
attgggaaggcagaagaaattctagatagttctaagattagtctgagctctaaaaaaaca
ggttctaagaagaaatcttcacaatttgaaggcacatttcttggttcagaatctgatgat
gattctgtacggacttcttcaagtcaaagatcacatgaattaaaattttcaagcattgaa
aaggaaagagattttaaaaagaactcagcacctttaaaaagtgaggatttagggaaatca
tcacgatctaaaccagagagagatgataaatattttagctactcaaaacttgaaagagat
actcggtatgtatcttctcgatgtaggtcagaaagggagcgaaggcggagcagatctcgt
tctagaactgacagaggctctagaactagtttatcttattcccggtcagaacgatctcat
tattatgagtctgatcggcgctaccataggagttccccttatcgagagaggacacgctat
tctcggccatatatagataacagagcacgagagagttctgactctgaagatgagtataag
aagacatactcgaggcgcaactcatctcattcctcctcttacagagacctaaggacatca
tcatcctactctaaatctgatcgggagtgcaaaactgagagctcttacttagaggcggag
agaagaggaaagtattcttcaaaactagaaagagaatccaaaaggacttcagaacatgaa
gcaataaaaagatgttctccccccagtgacctgggattccggcggggatcatcatattcc
aagcacgataatagtgtttcccggcataaatctgccctttcaaagcatatatccaagtct
gataaatttaaaaattctttctgttgcacagaattaaatgaggaaagcagacagtctcat
tcttttggtttacagactccttgttcaaaaggtagtgaattaagaacaaatagtaaaatt
cctgaaagagaaaagactgggtctccatctccatcagatcaattaaatgattcacctact
tttaaaaagctagatgagtcacctatttttaagtctgaatttataggacatgatagccat
gatagtattaaagaattggactcttcatcaaaagtgaagaaagatgaattaaaaagtttt
tgtcccattgaattaaatataaatggatctcctggggcaggatcagatgtggcagcattt
tgcacttctaaaactgatgctgttttcatgacttctgatgatagtgtgactggatcagag
gtatcccctttggtcaagacatgcatgctttcatcaaatggatttcagaatactagcaga
tgcaaagaaaaagacttggatgatagtaagtcaaaaagtccatttagagaaaccgaacct
ctagtgtcaccacaccttgataaactcatgtctttgtcagttacgactatagattattcc
aaaacagtagttaaagaatcagttgataagagagttccttgctacaaaaccaaagattcg
gatagatactgtactgcaaatgagagtaactcttcctcatgttatgaagctgaaaacatt
gacccttcagttatgaagatttcttcaaatagctttatgaatatgcatttggaatcaaaa
acagttaaatgtgataatagaaatctgacagatcagcactcaaaatttgcatgtgaagaa
tttaagcagaatgttggttgcactagttcagcttgcattaaccattttgatgatctacat
gagcctatagaaagttcaggtactgcttcatctcttcagaattttccatcaggaataaaa
gtggacagtttaactctcttgcagtgtgatgaggacacatctccagttttggatgcagtg
ctgaagagtaaaataagtacagagtttttaaagcatgcaggtaaagaaacaagagaaata
gatagtgcccttccagattcaagaaagggatttgcttcttgggaaaacaggcataataat
ggattatctgggaagtgtttgcaagaagctcaagaagaagggaattctgtgttgtctgac
agaagaagaccagaaatctctttagatgaagaaggaggaagaggacatgtgcatacttct
gatgactcagaagttgtattttcttcttatgatttgaatttaactatggaagacaatgat
agtgtaccttataccttaaaatgtgacagtagtggtcatgctccagaaattgtgtctact
gtccatgaagattattctggttcttcggaaagttcaagtgatgaaagtgattcagaagat
acagagtctgatgatagcagtgttccaagaaaccgtctccagtccattgtggttgtgcca
aagaattctactttgcccatggaagaaacaagtccttgttcttctcggagcagtcagagt
tacagacattattctgaccattgggaagatgagagagtggagtcaaggcgacattcatac
gaggaaaaattcgagaatatggcaagtaaaggatgtcttcaaactgaaaagttcttcctt
cataaaggaacagagaagaatccagaattttcttttgtacagttcaacagaaaacaagta
gagaagcacttgcctgacattgctcatcctcagagtgatggggttgatagtacaagtcat
acagatgtgaaatctgaccctctaggtcacctaaattcagaggatacagtaaaagccaaa
atgtctaggcagcaagaagaactgccagtttattcttctgatgattttgaagatgtccca
agtaagtctcggcaacagatcactttccctaataggccagatagtagactgggaaaaatg
gagctgaatttttcttctgtttgtgatatttctcgcatggatggcttgcattcttcagaa
gagctcagaaacttgggatgggacttctctcaacaagaaaggcctactagcacatatcag
caaccagacagcagctatggagcctgtggtacacacaagtatcagcaaagtacagaacag
tatggtggaacccgtaattactggcaaggcaatggctactgggatccaagatcagcaggt
agacctcctggaactggggttgcttatgaacgaattcaaggtcaggtaccagattcctta
acggatgaccgggaagaggaggagaattggaatcaacgaggtggatcccactttttaagc
cagtccaataaataccttctatcacttcagaaggacaagggatcagtacaagcacctgaa
ataagcagcaattccattaaagactctttggctgcaagtgaaaggaaagagttttcaaaa
aactttgaaaaaaatgatatcaaagatagaggacctcctaaaaaacggaggcaggaattg
gagagtgattctgaaagtgatggtgagcttcaggatagaaagaaagttagagtggaggtg
gagcaggaagagacatcagtgcctccacactcagagctaattggaccttcctgtgtcatg
gacgacttcagggacccacagcgatggaaggaatgtgccaagcaggggaagatgccttgt
tactttgatcttattgaagaaaatgtttatttaacagaaagaaagaagaataaatcccat
cgggatattaagcgaatgcagtgtgagtgtacacctctttccaaagatgaaagagctcaa
ggtgaaatagcatgtggggaagattgtcttaatcgtctccttatgatcgaatgttcttct
cgatgtccaaatggggattattgttccaatcgacggtttcagagaaaacagcatgcagat
gtggaagtcatacttacagaaaagaaaggctggggcttaagagctgccaaagatcttcct
tcgaacacctttgtcctggaatattgtggagaggtacttgatcataaagaatttaaggct
cgagtgaaggaatatgcacgaaataaaaacatccactactatttcatggctctgaagaat
gatgagataatagatgccactcagaaaggaaattgctcccgtttcatgaatcatagttgt
gaaccaaactgtgaaacccagaaatggactgtgaatggacaactaagagttgggtttttt
accaccaaactggttccttcaggctcagagttaacatttgactatcagttccaaagatat
ggaaaagaagctcaaaaatgtttctgtgggtcagctaattgccggggttacctgggagga
gaaaacagagtcagcatcagagcagcaggagggaaaatgaagaaggagagatctcgcaag
aaggattcagtagatggagagctagaagcattgatggaaaatggtgagggtctctctgat
aaaaatcaggtgctcagtttatcccggctgatggttagaattgaaactttggagcagaaa
cttacctgtcttgagctcattcagaacacacattcacaatcctgcctgaagtcctttttg
gaacgtcatgggctgtctttgttgtggatctggatggcagaacttggtgatggccgggaa
agtaaccagaaacttcaggaagagattataaagacattggaacacttgcccattcccact
aaaaatatgttggaggaaagcaaagtacttccaattattcaacgttggtctcagaccaag
acttctgtgcctccgttgagtgaaggagatggttattctagtgagaatacatcgcgtgct
catacaccacttaatacacctgatccttccaccaagctgaccacggaagtggacacagat
actcctaagaaactcatgtttcgcagacttaaaattataagtgaaaatagcatggacagt
gcaatctctgatgcaaccagtgagctagaaggcaaagatggcaaagaggaccttgatcag
ttagaaaatatcactgtagaagaagaggaagagttgcagtcgcagcagctactcccacaa
cagttgcccgagtccaaagttgaaagtgaaaccaccattgaggccagtaagctaccatct
gaactagaggctgacattgagatagagcctaaagacaacaatggcacaaaactggaagaa
actattgctgaggaaacaccatcccaagatgaagaggagggtgtgtctgatgtagaaagt
gagaggagtcaagaacagcctgataaaacagtggacataagtgatctggccactaagcta
ctggacagttggaaagacctaaaggaggtgtatcgaattccaaagaaaagtcaaactgaa
aaggaaagcacaataactgaacgaggaagggatgctgttgccttcagagatcaaacagca
gctccaaagactcctaacagatcacgagagagagacccagacaagcaaactcaaaataaa
gaaaaaaggaaacgaagaggctctgtttcaccacctccttctgcctatgaacggggaaca
aaaaggccagatgacagatatgatacgccaacttctaaaaagaaagtacgaattaaagac
cgcaataaactttctacagaggagcgccggaaattgtttgagcaagaggtggcccaacgg
gaggctcagaaacaacaacagcagatgcaaaacttgggaatgacatccccactgccctat
gactctcttggctataatgcctctcatcacccctttgctggctatccaccaggttatccc
atgcaggcctatgtggatcccagcaaccctaatgctggaaaggtacttctgcccacaccc
agcatggaccctgtgtgttctcctgctccttatgatcatgctcagcccttggtgggacat
tctacagaaactcttggtgcccctccaccagtgccagtggtgccacatgtggcagctcct
gtggaagtttctagctcacagtatgtaactcagagtgatggtgtggtacaccaagactct
agtgttgctgtcatgccagtaccagccccaggcccagtccagggacagaattacagtgtg
tgggattcaaaccaacagtctgtcaatgtacagcagcagtactctcctgcacaatctcaa
gcaaccatatattatcaaggacagacatgtccaactgtctatggtgtgacatcaccttat
tcacaaacagctccaccaattgtacagagttatgctcagccaagtcttcaatatatccag
ggtcagcagattttcacagcacacccacaaggagtggtggtacagccaactgcagccgtg
actgcaatagttgcaccagggcagcctcagcctttacagccacctgaaatggttgtgaca
aacaatctgctggatctaccacctccctctcctcccaaacccaaaaccattgtcttacct
ccgaactggaagacagcccgagacccagaagggaagatttattactaccatgtgatcaca
aggcagactcagtgggatcctcctacttgggaaagcccaggagacgatgccagccttgag
catgaagctgagatggacctgggaaccccaacatatgatgaaaaccctatgaagacatcg
aaaaagcccaagacagcagaagcggacacttccagtgaactggctaagaaaagcaaagaa
gtattcagaaaagagatgtctcagttcatcgtccagtgcctgaatccttaccggaaacct
gactgcaaagtgggcagaatcaccacgactgaagatttcaaacacctcgctcgcaagctg
actcatggtgttatgaataaggagctaaagtactgtaagaaccctgaagacctggagtgc
aatgagaatgtgaaacacaaaaccaaggagtatattaagaagtacatgcagaagtttggg
gctgtttacaaacccaaagaggacactgaattagagtga

DBGET integrated database retrieval system