KEGG   Castor canadensis (American beaver): 109689598Help
Entry
109689598         CDS       T04791                                 

Gene name
Kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B isoform X1
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109689598 (Kmt2b)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109689598 (Kmt2b)
Transcription factors [BR:ccan03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    109689598 (Kmt2b)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109689598 (Kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     109689598 (Kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain
Motif
Other DBs
NCBI-GeneID: 109689598
NCBI-ProteinID: XP_020024121
LinkDB All DBs
Position
Unknown
AA seq 2709 aa AA seqDB search
MAAAAGGGSCPWPGSARGRFPGRPRGSGGGGSRGGRGSGAERVRVALRRGGGAAGPGGAE
PGEDLALLRLLGFRRGLRRLRRLWAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDD
EEFQGFHSDEDVGPSSLRSALRSQRGRAPRGRGRKHKTTPLPPPRLADVSPIPPKTSARK
RGEEGTERMVQALTELLRRAQAPPVPRSRACEPSTPRRSRGRPPGRPAGPCRKKQQAVVV
AEAAVTIPKPEPPPPVVPVKHRTGSWKCKEGPGPGPGTPKRGGQPGRGGRGGRGRGRGGL
PLVIKFVSKAKRVKMGQLSLGLEPGQGQGQHGESCQDAPQRRVESGQEGGPCLKKQEQEM
EEERKEKKGEKDKEQGEEKEARPMVNEEVMLPKEKEEAKPLSLPLTPPTPPPPPPLPPPS
TSPPPLCPPPPPETPPPPPCSPPPPAPEEQEESPPPVVPATCSRKRGRPPLTPSQRAERE
AARAGPEGPFPPTPNPSTATGGPPEDSPTVTPKSTTFLKNIRQFIMPVVSARSSRIIKTP
RRFMDEDPPKPSKVEVSPLRPPIATSPLAPQEPAPVPSPPRAPTPPPTPVPLPEKRRSIL
REPTFRWTSLTQELPPPPPAPPPAPSPSPPPTPATPSRRPLLLRAPQFTPSEAHLKIYES
VLTTPLGAPEAPEPEPPPADDSPADPEPRAVGRTNHLSLPRFVPVVTTPVKAEVSPHGAP
TLSNGQQPLQALQTQLLPQALPPQQPQVQPQLQLQPLPSPQHTPPLERARIASLGSLPLS
GVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPPSPVGQMEEAVGTVKQAPDRGCVRSED
ESVEAKRERASGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLAT
EDTSSASETESVPSRSQRGKVESAGPGGDLEPAGSGGTLAHTPRRSLPSHHGKKMRMARC
GHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKT
LLPWDSDESPEASPGPPGPRRGAGAGGPREEVGAPPGPEEQDSLLLQRKSARRCVKQRPS
YDVFEDSDDSEPGAPPAPRRRTPREHELPVPEPEEQSRPRKPTLQPVLQLKARRRLDKDA
LAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPMVCL
LCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHL
LECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGATPGKNWDVEWSGDYSLC
PRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDS
VLYTCGPCAGATQPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQCGQDGKQLHPG
PCGLQAVGQRFEEGHYKSVHSFMEDMVGILMRHSEEGETPERRAGGQMKGLLLKLLESAF
GWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQELETPESGQPPGDPSAAFQ
GKDPAAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGS
LKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVFCQKH
TDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIRIDSLGTLSD
LSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVHLEAAEENQTIV
HSPVPSSEPPDHEDSLTDTDTLIPGAPEHHSPIPNLEPPLRPDSSSAPPLAPRSFSGARI
KVPNYSPSRRPLGGVSFRPLPSPGSPSSLAHYIPTVGDPDFPAPPRRSRRPSPLTPRPPP
SRRASPSLRTSPQLRVPPPTSVVTALSPTSGELAPPGLAPSPQPPPEDLGPDFEDMEVVS
GLSAADLDFAASLLGTEPFQEEIVAAGAVGSSHGGPGDSSEEEASPTTRYVHFPVTVVTG
PALAPSPLPGAPRIEQLDGVDDGTDSEAEAVQQPRGQETPPSGPGVGRAGVLGTAGDRAR
PPEDLPSEIVDFVLKNLGGPGEGAAGPREESLPLAPPLANGSQPSQGLPPSPADPTRTFA
WLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVPPPVKQPPLPPII
PPTTPTSWTLPPGPLLSVLPVVGVGVVRPAPPPPPPPLTLVFSSGPPSPPRQAIRVKRVS
TFSGRSPPAPPPNKTPRLDEEGESLEDTTHVPGLGSSGFSRVRMKTPTVRGVLDLDNPGE
ESLGHLQERSPLLPLPEGGPPRALDGSSDLLLESQWHHYSGEASSSEEEPPSPEDKENQA
PKRAGPHLRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLG
IHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNF
LASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHG
RGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGN
AARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCG
AKRCRRFLN
NT seq 8130 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgcccctggcctggctccgcgcggggccgcttc
ccgggccggccgcggggctccggcgggggcgggagccgcggcggacggggaagcggggcc
gaaagagtgcgggtagccctgcggcgcggcggcggcgcagcggggccgggcggagccgag
cccggggaggacctggccctgctccgtttgctggggttccgccggggcctgcgccggctc
cgccgcctgtgggccggcccgcgcgttcagcgaggccggggccggggccggggccggggc
tggggcccgagccgaggctgcgtgccggaggaggagagcagtgacggggaatccgacgat
gaggagtttcagggttttcattcagatgaagatgtgggccccagttccctgcgctctgcg
ctccgatcccagcgaggtcgagccccccgaggtcggggccgcaagcataagacgaccccc
cttcctcctcctcgcctagctgatgtgtctcctatccccccaaagacctctgcacggaaa
cggggtgaggagggcacagaacggatggtgcaggcactgactgaacttcttcggcgggcc
caggcacccccagtccccaggagccgggcatgtgagccctctaccccccgtcggtctcgg
ggacggcccccaggacggccagcaggtccctgccggaagaagcagcaagcagtagtagta
gcagaagcggctgtgacaatccctaaaccagagcccccacctcctgtggttccagtaaaa
catcgaactggcagctggaagtgcaaggagggacccggcccagggcctgggacccccaaa
cgtggaggacagcctgggagaggaggtcgtggaggcaggggcagaggccgaggagggctt
ccccttgtgatcaagtttgtttcaaaggccaaaagagtgaagatgggacaattgtcctta
gggcttgaaccaggtcagggtcaaggtcaacatggagaaagctgtcaggatgctccccag
agaagagttgaatctggacaggaagggggcccttgtttgaagaagcaggagcaggagatg
gaggaggagagaaaggagaagaaaggagagaaagacaaagagcagggagaggagaaggaa
gccagacctatggtcaatgaggaggtgatgctacccaaagaaaaggaagaggcaaagcca
ctatcattgcctctgactcctccaacccctccacctcctcctccccttccacccccctca
acatctccacctccactttgcccaccaccacctccagagaccccgcctccaccaccatgc
tctccaccacctccagctccagaggagcaggaagagtcccctcctcctgtggtcccagct
acatgctccaggaagaggggccggccgcctctgactcccagccagcgggcggagcgggaa
gctgcccgggcagggccagagggcccctttcctcccactccaaaccccagcaccgccaca
ggaggccctccagaagacagtcctactgtaacccccaaaagtaccaccttcctgaagaat
atccggcagtttattatgcctgtggtgagcgcccgctcctctcgtatcatcaagacccca
cggcgatttatggatgaagacccacccaaaccctcaaaggtggaggtctcacctctgcgg
cctcccattgccacctccccacttgctccccaggaaccagcaccagtcccatctccacca
cgtgccccaacccccccacctaccccagtgccactccctgagaagagacggtccatccta
agggaacccacatttcgctggacctcactaacccaggagctgccacctcctcctcctgcc
cctccaccagccccatctccatccccgccacctacccctgccaccccttctcggaggccc
ctgctccttcgggcacctcagtttaccccaagtgaagcccacctgaagatctatgaatcg
gtgcttactactcctcttggagctcctgaagcccctgagccagagcctccacccgctgat
gactctccagctgaccctgagccacgggcagtgggccgcaccaaccacctcagcctgcct
cgatttgtccctgtggtcaccactcctgttaaggccgaggtgtccccccatggggctccc
actctgagcaatgggcagcagcccttacaggccttgcagacccagcttctgccccaggca
ctaccaccacagcagccacaagtacagccacagttacagctgcagccactaccatcacca
cagcatacaccaccactggaaagggcccggattgcaagcctgggatctctaccactgtct
ggggtggaagagaaaatgttcagcctcctcaagagagccaaggtgcagctatttaagatc
gaccaacagcaacagcagaaggtggcagcatcgatgccgccaagccctgtaggacaaatg
gaggaggccgtggggactgtcaagcaggctccagacagaggctgtgtcaggtctgaagat
gaatcagtggaagctaagagagaacgagcctcgggccctgagtcccctgtgcaaggcccc
cgaatcaaacatgtctgtcgtcatgctgctgtggccctgggtcaggctcgagccatggta
cctgaagatgtcccccgactcagtgccctccctctccgggatcggcaggaccttgccaca
gaggatacatcatcagcatctgagactgagagtgtcccatcccggtcccagcggggaaag
gtggaatcagcagggcctgggggagacttggagcctgcagggtctggagggaccctagcc
catacaccccggcgctcgctgccctcccatcatggaaagaagatgcggatggctcggtgt
gggcactgtcggggctgcctgcgtgtgcaggactgtgggtcctgtgtcaactgcttagac
aaacccaaatttgggggtcccaacaccaagaagcagtgctgtgtataccggaaatgtgac
aaaatagaggctcggaagatggaacggctggccaaaaaaggccggacgatagtgaagacg
ctgttgccctgggattcggatgaatctcctgaggcctcccctggtcctccaggcccacgc
cggggggcgggagctggggggccccgggaggaggtgggggccccccccgggcccgaggag
caggactccctcctactgcagcgcaagtcagcacggcgctgcgtcaaacagcggccctcc
tatgatgtcttcgaggattcagatgactcggagcccggggctcctcctgctcctaggcgt
cggacccccagagaacatgagctgccggtgccagaacctgaggagcagagccggccccgc
aaacccaccctgcagcctgtgttgcagctcaaggcccgaaggcgcctggacaaggatgct
ttggctcctggcccctttgcctcttttcccaatggctggactgggaaacagaagtctcct
gatggagtgcaccgggtccgtgtggattttaaggaggactgtgacctagagaatgtgtgg
ctgatgggtggccttagtgtgctcacttctgtgccaggggggccaccaatggtgtgcttg
ctatgtgccagcaaagggctccatgagttggtgttctgccaagtctgctgtgaccctttc
cacccattctgcctggaggaggctgagcggcccttgccccagcatcatgacacctggtgc
tgccgccgttgcaagttctgccatgtctgtggacgcaaaggccgaggatccaagcacctc
ctggagtgtgagcgctgccgccatgcctaccacccagcctgcctggggcctagctacccg
acccgggccacacgcagacggcgccactggatttgttcagcctgtgtgcgctgtaagagc
tgtggggcaactccaggcaagaactgggatgtcgagtggtctggagattacagcctctgc
cccaggtgcacccagctctatgagaaaggaaactactgcccaatttgcacacgctgctat
gaagacaatgactatgagagcaagatgatgcagtgcgcacagtgtgaccactgggtgcat
gccaagtgtgaggggctctcagatgaagactatgagatcctttctgggctgcccgactcg
gtgctgtacacgtgtgggccatgtgctggggccacacagcctcgctggcgagaggccctg
agtggggccctccaggggggcctgcgccaggtgctccagggcctgctgagctcaaaggtg
gcaggcccattgctgctgtgtacccagtgtgggcaggatgggaagcagctgcacccagga
ccctgtggtttgcaagctgttggtcagcgctttgaggaaggccactacaagtctgtgcac
agcttcatggaagacatggtgggcatcctgatgaggcactcagaagaaggcgagacgcca
gagcgccgggctggaggccagatgaaggggctcctactaaagctgctagagtctgcgttc
ggctggttcgacgcccatgaccccaagtactggcgacggagtacccggctgccaaatgga
gtcctccctaatgcggtgttgcctccatccctggaccatgtctatgctcagtggagacag
caggaactagagaccccagaatcaggacagcctccaggggatccctcagcagctttccag
ggcaaggatccagctgctttctcacatctagaggacccccgtcagtgtgcactctgcctc
aagtatggggatgcagactccaaggaggcagggcggctcctgtacattgggcagaatgag
tggacacatgtcaattgtgccatatggtcagctgaagtgtttgaggagaatgacggctcc
ctcaagaatgtgcacgctgctgtggctcgagggaggcagatgcgctgtgagctctgcctg
aagcctggagccacagttggctgctgcctgtcctcctgcctcagcaacttccacttcatg
tgtgcccgggccagctactgcatctttcaggacgacaagaaagttttctgccagaaacac
acagacctcctagatggcaaggagattgtgacccccgacggttttgatgttcttcgtcga
gtctatgtggactttgagggcatcaacttcaagcgaaaattcttgacagggcttgaacca
gatgccatcaatgtgctcattggctccatccgaattgactccctgggtactctgtctgac
ctttcagactgcgaaggacggctcttccccattggctaccaatgctcccgtctgtactgg
agcacagtggatgctcggaggcgctgctggtaccggtgccgaattctagagtatcgccca
tgggggccaagggaggagcccgttcacctggaggcagcggaggagaatcagaccattgtg
cacagccccgtcccttcctctgagcccccagatcatgaggactccctgacagatacagat
accctaatccctggagctcctgagcaccactcacccattccgaatctggaacccccactg
cggccagattcaagcagcgcccctcctcttgccccccgctccttctcaggggctcgaatc
aaagtgcccaactactcgccatcccggaggcccttggggggtgtctcctttcgccccctg
ccatcccctggaagtccatcttctctggcccactacatacctacagtgggagacccggac
ttcccagctccccccaggcgctctcggcgtcccagccctctgacccccaggccgccacca
tcacggcgggcctcaccttctctcagaacttcccctcagctcagggtgccccctcctacc
tcagttgttacagccctctcacctacctcaggggagctggctccccctggcctggcccca
tctcctcagcccccacctgaagacctgggcccagactttgaggacatggaggtggtatca
ggactgagtgctgctgacctggactttgcagccagcctgttggggactgagcctttccag
gaagagattgtggccgcaggggcagtggggagcagccatgggggcccaggagacagctca
gaggaggaggccagccccaccacccgctatgtccacttccctgtgactgtcgtgactggc
cctgctctggctcccagccccctccctggagccccccgaatcgagcagctggatggagtg
gatgatggcacagacagtgaggcagaagcagtccagcagccacggggccaagagactcct
ccttcagggccaggagtgggccgagctggggtccttgggactgcaggagacagggcccga
cctcctgaagatctgccttcagaaattgtggattttgtgttgaagaacttaggggggcct
ggggagggggctgctggtcccagagaggagtcacttcccctagcacctcctctggccaat
ggcagtcagccctcccaaggcctgccccctagcccagccgaccccacccgaacatttgcc
tggctccctggggccccaggggtccgggtgttgagcctgggcccagctcctgagccccct
aaacccgccacatctaagattattcttgttaacaagctggggcaggtattcgtgaagatg
gctggggagggagaacctgtcccacccccagtaaagcagccgcctctgccccctatcatt
ccccccaccacccccacatcctggactctgcccccagggcccctgcttagtgtgctgcca
gtggtaggagtaggggtggtacgccctgccccacctccacccccacccccactgacactg
gtgtttagcagtgggccccccagcccaccccgccaggccatccgtgtcaagagggtatct
accttctctggccgttccccaccagcacctcccccaaacaaaaccccccggctggatgaa
gagggggagtccttggaggataccacccacgttccagggcttggtagcagtgggttcagc
cgagtaaggatgaaaacacccactgtgcgtggagttcttgacctggacaatcctggggag
gaaagcctggggcacctccaggaacggtcccctttgctgccacttccagaaggtggccct
ccccgggcccttgatggctcctcagacctgctgcttgagtcccagtggcaccattattca
ggtgaggcctctagctctgaggaagaacctccgtccccagaagacaaagagaatcaggct
ccaaaacgtgctggcccacacctgcgctttgagatcagcagtgaggatggcttcagtgtg
gaagcagagagcttggagggggcatggagaactctgattgagaaagtgcaagaggcccga
gggcatgcacggctcagacatctctcctttagtggaatgagtggcgcaaggcttctgggc
atccaccatgatgctgtcatcttcctggcagagcagctgccaggggcccagcgctgccag
cactataagttccgctaccaccagcagggagagggccaggaggagcctcctctgaatccc
cacggtgctgcccgtgctgaggtctatctccggaagtgcacctttgacatgttcaacttc
ctggcctcacagcacagggtgctccctgagggggcaacctgtgatgaggaagaagatgag
gtgcagctcaggtcaaccagacgtgccaccagcctggagctgcccatggccatgcgcttt
cgccacctcaagaagacgtccaaagaagctgtgggtgtctacagatcagccatccacggg
cgcggcctgttctgtaagcgcaacatcgatgcgggcgagatggtcattgagtactctggc
atcgtcattcgctctgtgctgactgacaagcgggagaagttctacgacgggaagggcatt
gggtgctacatgttccgcatggatgactttgacgtggtggatgccaccatgcatggcaac
gccgcccgcttcatcaaccattcatgtgagcccaactgcttctctcgcgtcatccacgtg
gagggccagaagcacatcgtcatctttgccctgcgtcgcatcctgcgtggtgaggagctc
acctacgactacaagttccccatcgaggatgccagcaacaagctgccctgcaactgtggc
gccaagcgctgccgtcgcttccttaactga

DBGET integrated database retrieval system