KEGG   Castor canadensis (American beaver): 109692146Help
Entry
109692146         CDS       T04791                                 

Gene name
Hdac6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan05034  Alcoholism
ccan05165  Human papillomavirus infection
ccan05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    109692146 (Hdac6)
  Substance dependence
   05034 Alcoholism
    109692146 (Hdac6)
  Infectious diseases
   05165 Human papillomavirus infection
    109692146 (Hdac6)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109692146 (Hdac6)
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109692146 (Hdac6)
Messenger RNA biogenesis [BR:ccan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     109692146 (Hdac6)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    109692146 (Hdac6)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109692146 (Hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 109692146
NCBI-ProteinID: XP_020028174
LinkDB All DBs
Position
Unknown
AA seq 1273 aa AA seqDB search
MEKRASGARGPTGRREFGGANQGRSLRKGLRSSRGRAAASPAMTSTGQDSTTTRHRKSRH
NPQSPSHDLSITSKRSVKKGAAPRSTPNLAEIKKKGKMKKLSQKVEEDLIVGLQGLDLNP
EVKIVTGTGLVFDEQLNEFYCLWDDSFPESPERLHAIKEQLIQESLLDRCVCFQARFAEK
EELMLVHSLEYIDLMEMTQYMNEGELRVLASTYDSVYLHPNSYSCACLASGSVLRLVDAV
LGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQKKHRIQRVLIVDWDVHHGQ
GTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSATGFGQGQGYTINVPWNQVGMRDAD
YIAAFLHILLPVAFEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKL
ILSLEGGYNLHSLAKGVSASLHTLLGDPCPMLESPGVPCRSAQTSLSCTLEALEPFWGIL
VRSVDTPEEDGEEEDTVEETEEGPWEASALPVLTWPVLQHRTGLVYDQRMMSHCNLWDNH
HPETPQRILRIMCHLEELGLAAHCLILPVRAATDAELLTCHSAEYVERIRATEKMKTREL
HREGANFDSIYLCPSTFTCAQLAAGAACRLVEAVLSGEVLNGIAVVRPPGHHAEHAAACG
FCFFNSVAVAARHAQTISGRALRILIVDWDVHHGNGTQHIFEDDPSVLYVSLHRYDRGTF
FPMGDEGASSQIGRAEGTGFTVNVPWNGPRVGDADYLAAWHRLVLPIAYEFNPELVLVSA
GFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGHIILILEGGYNLTSISESMAACTHSLL
GDPPPLLPLLRPPQPGALASITETIQVHRRYWRSLRVMKVEDKETSSASKPVTKKASHPT
NPKLAKGVTMPEGKILRAGMKKATSTLPAKESTPGQTKSKTANVATLTQDQCLERATGGA
KLDQTTSEETVERATVDQTTSEESVGGATVGQATTEESVGEATVDQATTEESVEEAAVEQ
ATTEETVEGATGDEATSVESVRGARVDQVNSEAATGEVMLDQTTSEETAGESEVIQTPLA
SNTDKQTPAASPVRGATAQSSPCQLIGSHRILELGNETQETLESQTLGEEGLLGEAAGGQ
DTDCSVLMQDFGELGDSDEDIFYAVTPLSWCPHLGAVCPIPEEGLDTAQPCERCGTFEEN
WLCLSCYKIYCSRYVSAHMVCHFEASRHPLVLSCVDLSAWCYICQAYVHHQDILHVKNVV
HQIKFGEDIPQPH
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagggcatccggtgcccgaggccccacaggtcgccgggaatttggcggtgcg
aaccaagggcggagtttgagaaaagggctgcgctcaagccgcggcagagctgcagcctcc
ccagccatgacctccaccggccaggattccaccactaccagacatcgtaagagtagacac
aacccccagtcgccctctcacgacttgagcattacctcgaaacgaagtgttaagaagggt
gctgcaccccgctccactcccaatctagcagaaataaagaagaaaggcaagatgaagaag
ctgagccaaaaagtcgaagaagacctaatcgtggggctgcaagggctggatctgaaccct
gaggtcaagatagtgacgggcactggccttgtgtttgatgagcagctaaatgaattctac
tgtctctgggatgacagcttccctgaaagccctgagcgactccatgccatcaaggagcag
ctgatccaggagagtcttctcgatcgctgtgtgtgctttcaggcccggttcgcagaaaag
gaggagctgatgttggttcacagcctagagtacattgatctgatggagatgacccagtac
atgaatgagggagaactccgcgtactggcaagcacctatgattcagtttatctgcatccg
aactcatactcctgtgcctgcctggcctcaggctctgttctcaggctggtagatgccgtc
ctgggagctgagattcgaaatggcatggctatcatcaggcctcctggacaccatgcccag
cacagtcttatggatgggtattgcatgttcaaccatgtggctgtggctgcccgctatgct
caaaagaaacaccgcattcagagagtccttattgtggattgggatgtacaccacggtcaa
ggaacacagttcaccttcgaccaggaccccagtgtcctctatttctctatccaccgctat
gagcagggtcgattctggccccaccttaaggcctctaactggtctgccacaggttttggt
caaggccaaggatacaccatcaatgtgccttggaaccaggtggggatgcgggatgccgac
tacattgctgctttcctgcatatcttgctgccagttgcctttgagttccagcctcagctg
gtcctagtagctgctggatttgatgccctccaaggggaccccaagggtgagatggctgcc
actccagcagggtttgcccagctaacccacctactcatgggtttggcaggaggcaagctg
attctgtctctagagggtggctacaaccttcactcccttgctaaaggtgtcagtgcatca
ctccacacccttttgggagacccttgccccatgctggagtcccctggtgtgccctgtcga
agtgcccagacttcactctcctgtactctggaagccctagaacccttctggggaatcctt
gtgagatcagtagacactccagaggaggacggcgaggaggaagacactgtggaggagacc
gaggaaggaccctgggaagcctctgcgctaccagtcttgacatggccagtgctgcagcat
cgcactggtctggtctatgaccaaagaatgatgagtcactgcaacctatgggacaaccat
caccccgagacacctcagcgtatcttgcggatcatgtgccacctggaggagctgggcctt
gccgctcactgcctcatcctgcctgtgcgggctgccacagatgccgagctgctcacctgc
cacagtgctgagtatgtggagcgtatccgggccacagagaagatgaagacccgggagttg
caccgcgaaggtgccaactttgactccatctacctctgtcccagcaccttcacctgtgcg
cagctggctgcaggcgctgcctgccgcctggtggaagctgtgctctcaggagaggttttg
aacggtattgcagtggtgcgccccccaggacaccatgctgagcatgctgctgcttgcggt
ttctgctttttcaactctgtggctgtggctgctcgccatgctcagaccatcagtgggcgt
gccctgaggatcctgattgtggattgggacgtccatcacggcaatggaactcagcacata
tttgaggatgaccccagtgtgctatatgtatccctgcaccgatatgaccgtggcaccttc
ttccccatgggggatgagggtgccagcagccagataggccgggcagagggcaccggcttc
actgtcaatgtaccctggaatggaccccgcgtgggtgatgctgactacctggctgcctgg
catcgtcttgtgcttcctattgcctatgagtttaacccagaactggtactggtctcagct
ggctttgacgctgcacgaggggacccgctaggaggttgccaggtgtcacctgagggttat
gcccacctcacccacctgctgatgggccttgccaatggtcacattatccttatcctagag
ggtggctacaacctgacatctatctcagagtccatggctgcctgcacccactccctcctt
ggagacccgccaccactactgcccttgctgcggcctccgcaaccaggggccttggcttca
atcactgagaccatccaagttcatcgcagatactggcgcagtttgcgggtcatgaaggta
gaagacaaggagacatcttccgcttctaagcccgtcaccaagaaggcatcccatccaacc
aatcctaaattggctaaaggggtgaccatgccagaagggaagattctgagagcaggcatg
aagaaggctacctcaacattacctgcaaaagagtctactccaggacagactaaatcaaag
acagctaatgtagccacactcactcaggaccagtgcttagagagagccactgggggagct
aaactagaccagaccacctcagaggagactgtggaaagagccacagtggaccaaaccacc
tcagaagagtctgtgggaggagccacagtgggtcaggccaccacagaggagtctgtggga
gaagccacagtggaccaggccaccacagaggagtctgtggaagaagctgcagtggagcag
gccaccacagaggagactgtggaaggagctacaggggacgaggccacttcagtggagtct
gtgagaggagccagagtggaccaggtcaactcagaagcagccacaggggaagtcatgctg
gaccagaccacttcagaggagactgcaggagaaagtgaggtgattcaaactcctctagcc
tcaaacacagacaagcagactccagcagcctcacctgtgcggggagccacagcccagtca
tccccctgtcagctgattgggagtcacaggattttggaactaggcaatgaaactcaggag
accctagagtctcagaccctaggagaagagggcttactaggagaggcagctggaggtcag
gacactgactgctcagtgctgatgcaagactttggggaacttggtgacagtgatgaggac
atattttatgctgtgacaccactgtcctggtgtccccatttgggggcagtatgccccata
cctgaagaaggcctggacacagctcagccttgtgaacgctgcggaacatttgaggagaac
tggttgtgtttatcttgctataagatctactgtagtcgctacgtcagtgctcatatggtg
tgccactttgaagcctctagacacccactggtcctcagctgtgtggacctgtctgcctgg
tgttacatctgtcaggcctatgtccaccaccaggacatcctgcatgtgaagaatgttgtc
caccagatcaagtttggggaggacattcctcaaccacactaa

DBGET integrated database retrieval system