KEGG   Castor canadensis (American beaver): 109699996Help
Entry
109699996         CDS       T04791                                 

Gene name
Aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00010  Glycolysis / Gluconeogenesis
ccan00053  Ascorbate and aldarate metabolism
ccan00071  Fatty acid degradation
ccan00260  Glycine, serine and threonine metabolism
ccan00280  Valine, leucine and isoleucine degradation
ccan00310  Lysine degradation
ccan00330  Arginine and proline metabolism
ccan00340  Histidine metabolism
ccan00380  Tryptophan metabolism
ccan00410  beta-Alanine metabolism
ccan00561  Glycerolipid metabolism
ccan00620  Pyruvate metabolism
ccan01100  Metabolic pathways
Module
ccan_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ccan_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109699996 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    109699996 (Aldh7a1)
   00620 Pyruvate metabolism
    109699996 (Aldh7a1)
  Lipid metabolism
   00071 Fatty acid degradation
    109699996 (Aldh7a1)
   00561 Glycerolipid metabolism
    109699996 (Aldh7a1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109699996 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    109699996 (Aldh7a1)
   00310 Lysine degradation
    109699996 (Aldh7a1)
   00330 Arginine and proline metabolism
    109699996 (Aldh7a1)
   00340 Histidine metabolism
    109699996 (Aldh7a1)
   00380 Tryptophan metabolism
    109699996 (Aldh7a1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109699996 (Aldh7a1)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109699996 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     109699996 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     109699996 (Aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109699996
NCBI-ProteinID: XP_020040552
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MWRWAGAGCVQAVKTCKLPGRRDRPAALMSTLLINQPQYAWLRELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVKKAREAWKVWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMISGNACLWKGAPTTSLISVAVTKIVARVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGKSLLELGGN
NAIIAFADADLSLVVPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSDVLYGPLHTKQAVNMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
SSIVHTETFAPILYVLKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgggcaggcgctggctgcgtgcaagctgtgaagacctgcaaacttccagga
cgtcgggaccggcctgccgccctcatgtccactctgctcatcaatcagccccagtatgcg
tggctgagagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctggggc
ggccggggagaggttattacgacctattgtcctgccaataatgagccaatagcaagagtc
cgacaggccagtatggcagactatgaagaaactgtaaagaaagcaagagaagcttggaaa
gtctgggcagatattcctgctccaaagcgaggagaaatagtaagacagattggtgatgcc
ttgcgggagaagatccaagttttaggaagcttggtgtctttggagatggggaagatctta
gtggaaggcgtgggagaagtgcaagagtacgtagatatttgtgattatgctgttggcttg
tcgcggatgatcgggggacccatcttgccttctgaaagacctggccatgcactcatcgaa
cagtggaaccctgtcggcttagttggaatcatcactgcattcaactttccagtggcggtg
tacggctggaacaatgccattgcaatgatctctgggaatgcctgcctctggaaaggagct
ccaacgacttccctcattagtgtagctgtcactaagatagtagccagggtgctggaagat
aataagctgcctggcgcaatttgttccttgacctgtggtggagcagatattggcacagcg
atggccaaagatgagcgagtgaatctgctgtccttcactgggagcactcaggtgggaaaa
caagtggcccttatggtgcaggagaggtttgggaaaagtttgttagaacttggaggaaac
aacgccattattgcttttgcagatgcggacctcagcttagttgttccgtcagcgctcttt
gctgccgtagggacagctggccagaggtgcaccactgtgaggcgactgtttttacatgaa
agcatccatgatgaagttgtaaatagacttaaaaaggcctatgcacagatccgtgtcgga
aacccatgggactctgatgttctctacggaccactccacaccaagcaggcagtgaacatg
tttcttggcgctgtggaagaagcaaagaaagaaggaggcacagtggtctacgggggcaag
gttatggatcgcccaggaaattacgtggaacccacaattgtgacaggtctcgcccatgac
tcatccattgtgcacacagagacttttgctccgattctctatgtcttaaaattcaagaat
gaagaagaggtctttgcgtggaataatgaagtgaagcagggactttcaagtagcatcttt
accaaggatttgggccgaatattccgctggcttggacctaaaggttcagactgtggcatc
gtcaatgtcaacattccaaccagcggggccgagattggaggtgcttttggaggcgagaag
cacactggtggtggcagggagtcgggcagcgacgcctggaagcagtacatgaggaggtcg
acttgcaccatcaactacagtaaggaccttccactggcccaaggaatcaagttccagtaa

DBGET integrated database retrieval system