KEGG   Cyprinus carpio (common carp): 109054791Help
Entry
109054791         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1A-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109054791
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109054791
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109054791
   HMT complexes
    COMPASS/SET1 complex
     109054791
    COMPASS/SET1 complex (yeast)
     109054791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 109054791
NCBI-ProteinID: XP_018927572
LinkDB All DBs
Position
6
AA seq 2476 aa AA seqDB search
MDPDSGADTQRTLSLQWKSYKLVQDPALRRVTQKIYRYDGIHFSVQDSGFPPVGDLRDPR
PRRIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLI
VSGSYTPQTVPTGGKALTEKFQPPAPTQPDTSSDIRRRLSTDQMAAPAAPLNSGSTTPCS
VDTGFADQRLDTPPTSLGGAYTPGSSASSQGGGTPYTPRSGTPFSQDSGYSVGRHSGYSS
TQSYPQQDMLPSSSCSSSAVSSSSGFKPPHFHEDLHAPPPQEPSMFHRGRPGYPPSVPFR
PNEPPFPYPSVGGSGMHMPLHPPMPPPGPQFEPPPLSDRDRERERGHRDRERDSGGRYGG
GISSRRSSYHYQQETNSSSTAKSYHSHHSHYADRREDRDGRGYRRDSSGSRSGDHGRHRN
HHHSHNHHSSGGGGSSRRRSSRDREWERDREGDYNSSDPRYGGHSNSSQHSSNSLSPPSA
TSSYGGNSSSKDLSPYDTPSSSRLEPSPAFRPQQGAGERGFGMGGSMDNDYRAHSHHTPL
APPPPPPPLPPASVIAAAVAETLGSLDFGQDSPIREEQWTKPKRFPSTPPHPPRTPPTSS
PPHVSIPSSSTSPSSTSLPHHLPSSTASLSPPPPQRDSSPEPDSTNESLPFMHHSSSLDS
RIEMLLKEQKPDSTNESLPFMHHSSSLDSRIEMLLKEQKAKFSFLASDDEDDEKEEDRER
GKTGENADSGGKKLKEENGERPSHKRQGETEGGQQRRRGEKDARRSRGKRQGGGVGEGRK
TPPEVASSTPTTHSLVSESLQGQMPHPQEEHTTSDTHRAPHTPPTYNGEAQEDEDSDKVD
DSEAHTRLFPTHPPHSTSGHLRPPSPPSPSPIPSILHPLPSSTSLPHHLPSSTASLSPPP
PQRDSSPEPDSTNESLPFMHHSSSLDSRIEMLLKEQKAKFSFLASDDEDDEKEEDRERGK
TGENADSGGKKLKEENGERPSHKRQGETEGGQQRRRGEKDARRSRGKRQGGGVGEGRKTP
PEVASSTPTMHSLVPETLQGQMLAPQEEHITSDSHRAPHTPPTYNGEAQPSPHSSGEDME
ISDEDDSAITTVTPHPAASSSSSPATSSQSALPSQTPDPSASPAPDTSQHFSATMPPPPI
PSYPPHLPPPPLPGFSLQPPPPPGIPPPLPHMELHPEYPPPLPHHMYDYASSMELMSQYC
GGAPMSFQMQTHMLSRLHQMRMASSNSSTAPPGEVPPASEYPPSFHLHSIPPPPHHPHHP
YMDQDGNVATHYDQDHRYIPPHLPYAYPDPHAAQLPHHHTIPPPHSPWPPHLLPQQFPSH
YPPPGFGTVPGVDGELYGAAGDQMAIMGHNPYEAVVQQVLAALIEEMKNIMQRDLNRKMV
ENIAFGTFDEWWDRKEQKAKPFQTAMRGVAVVREEDKKDEKTSNRPREPLMSLVDWAKSG
GMEGLSLRGALRLPSFKVKRKEPQELVEGGELKRARPSTPPDEEDEDSYQGKSADTAAGR
TEERRVAERRAARRRSRAKARKPYDLDSEGEETSDGSSSEKEEDEDSDKVDDSEGMQLSC
FVFCTKLINLGCCCYVHFILGFYVSIVKFTLFFLSLPEEEKTATAVPPSSPYPRPPSPIL
LLPPLKKRRKTVSFSVEESEFKPSILSPSAPSLSPTPVSQASDIPTSSSPVSTPTAAASA
GASKPTPMLLPFASRPNESNALTSPASPSAVLTVPPPVRSLRPDEPKKSPGLPPSPQTPT
AKNSSKRGKDSPRTPPTPVCLTVQNLPLDHASLVKVAYEDPIPTPTTQKGRARGRTRTLS
QSASSPHLHPALEEEEEDEEELEQRLKLREQLGVSSLLQLASAPKPDLSVLADVALKMDP
EADIDSEETETSDEAEEHKLEEEEGDFFAPHPRQPLPDPEGLFVLQEHNYSKTAPAPPHL
TSPQKRTKQDPTVLLPADLNQHGVQEAPEEVIGDALAARGEAPELYEDFSGMGLLCDARD
TAETQTKTLGPQHKRRGSISKEMEMEERGKGKSKKRSRKDKXNEELEISKKQKEKQIKKQ
RKRKLEEYEEDVDVEQLESGELSSSSSESGDSDFGLERSLEFEKEEVRKSERLFLQEAGL
TPSTQRRSKHVPTPAPVPQPSYKNRSEFEQMTILYDIWNSGLDQEDMRLLKSTYEKLLQD
DHATDWLNDTHWVPHTITNIPNPRRKKKTADGQLRQHVTGCARSEGYYAISRKEKDVYLE
LDQPVTVQEAGEYDTSGSNRQLSERRSEQRRLLSAIGTPAVMDSDLLKLNQLKFRKKKLR
FGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMAADNREKRYAQEGIGSSYLFRVDHDT
IIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPIEEN
KIPCLCGTENCRGTLN
NT seq 7431 nt NT seq  +upstreamnt  +downstreamnt
atggatccggacagtggggcggacactcagcgaactctcagtctgcagtggaagagctat
aagctagtacaagaccctgctctccgacgggttactcagaaaatctacagatatgatggg
attcattttagtgtacaggattcaggattcccgcctgtgggggacttgcgtgatccaaga
ccccgcagaatctggtctagacacacagagctgtcgctgccagtgcccaagtttaagttg
gacgagtattacgtaggtcccataccacttaaggaagtgacgtttgcgaggttgaatgat
aacatcaaagagccgttcctggcagagatgtgcgccaagtttggtgaggttgaggagatg
gagattctgtttcatcccaagactcggaagcatttgggcttggcccgtgtcctcttcacc
agcactagaggggccaaagacaccgtcaaacacctgcacaatacttctgtcatggggaac
attgtccacgtccagctagatatcaaaggccaacagaggatgaagtactatgacttaata
gtgagtggctcatacacccctcagacagtcccgactggaggcaaagccctcacagagaaa
tttcagcccccagccccgactcagccagacacgtcgtctgatatccggcggaggctctcc
acagatcagatggcagctcctgctgctcctctaaactctggcagcaccaccccctgttct
gtggacactggatttgcagaccagcgtctagacacccctccaacctctctgggaggagct
tatacgccgggttcctctgcttcttcacagggcggcggcaccccttacacccctcgctct
ggaacccctttctcccaagactcgggatactctgtgggcaggcacagtggctatagcagc
actcaaagttatccccagcaggatatgcttccatcttcctcctgctcctcttcagcagtc
tcctcatcatcaggatttaagccccctcactttcacgaggacctacacgctccacctccg
caagaaccttccatgttccacaggggacggccgggatatcctccttctgtgcccttcaga
cctaatgaacctccctttccgtatcccagtgttggaggttcagggatgcacatgccgctg
catccacccatgccacctccggggcctcagtttgagccaccaccactgtccgacagagat
agagaaagagaaaggggacacagggatcgggagagagactcaggagggcgctatggaggc
gggataagctccagacggtcctcttaccactaccaacaggaaacaaactcctcgtccaca
gccaaatcctaccattcacatcactcgcattacgctgatcggcgggaggacagggacggc
aggggctaccggcgcgacagctcaggctcccgctcaggagatcacggaaggcatcggaac
caccatcactcccacaatcaccacagcagcggcggaggtgggtcgagccggcggaggagc
agcagagaccgggaatgggagcgagacagagaaggagactataacagctccgatccacgt
tatggaggccactcgaactccagccaacactcgtccaatagcctctcccctccctctgcc
acctcctcttatggaggaaactcgtcgtctaaagacctgtccccctacgacacaccttca
tcctcccggctagagccctcgccggctttccgtcctcagcagggtgcaggcgagaggggt
tttgggatgggaggaagcatggataatgactaccgtgctcattctcaccacacgcccctg
gcgccaccacctccacctcctcccctcccgccagcctctgtcatcgcagccgctgtggct
gaaacgcttggctctcttgattttggtcaggacagtcccatccgagaagaacagtggacc
aaacccaaacgctttcctagcaccccgccccatccacctcggacacctccgacctcctcg
cctcctcacgtctcaatcccgtcatcctccacctctccatcctccacctccctgcctcac
cacctcccctcttcgacagcatccctctctccgcctcctccacagcgtgactcgtccccg
gagcctgactccaccaatgagagcctgccgttcatgcaccacagcagcagcttggactcg
cgtattgagatgttgctgaaggaacaaaaacctgactccaccaatgagagcctgccgttc
atgcaccacagcagcagcttggactcgcgtattgagatgttgctgaaggaacaaaaagcc
aagttttctttcctggcctcagatgatgaggacgatgagaaggaggaggacagagagagg
ggaaaaacaggcgagaatgcagacagtgggggaaagaaactcaaagaggagaatggggaa
aggcctagtcacaagagacaaggagagacggagggaggccagcagaggaggagaggagag
aaagatgcacgccgcagcaggggcaaaaggcaagggggtggagtgggtgaaggcaggaaa
acacctccagaggtggcctcttccactcccactacgcacagtttggtgtcagagtctctt
cagggccaaatgccgcaccctcaggaggagcacacaacctctgacacacacagggctcca
cacaccccacccacctacaatggagaggcacaggaggatgaagacagtgacaaagtggat
gattcagaagcgcacacgcgtctgtttcctacgcacccgccccactccacctccggacac
ctccgacctccctcgcctccctcaccgtctccaatcccgtccatcctccaccctctccca
tcctccacctccctgcctcaccacctcccctcttcgacagcatccctctctccgcctcct
ccacagcgtgactcgtccccggagcctgactccaccaatgagagcctgccgttcatgcac
cacagcagcagcttggactcgcgtattgagatgttgctgaaggaacaaaaagccaagttt
tctttcctggcctcagatgatgaggacgatgagaaggaggaggacagagagaggggaaaa
acaggcgagaatgcagacagtgggggaaagaaactcaaagaggagaatggggaaaggcct
agtcacaagagacaaggagagacggagggaggccagcagaggaggagaggagagaaagat
gcacgccgcagcaggggcaaaaggcaaggtggtggagtgggtgaaggcaggaaaacgcct
ccagaggtggcctcttccactcccactatgcacagtttagtgccagagactctacagggc
caaatgctggcaccgcaggaggagcacataacctctgactcacacagggctccacacaca
ccacccacctacaatggagaggcacagccttctcctcactcctctggggaggatatggaa
atatccgatgaagatgacagtgccatcaccacagtgaccccccatcctgctgcctcttca
tcctcctcaccggccacctcctcgcaatctgccctcccctcccaaaccccagacccctct
gcgagtcccgccccggacaccagccagcacttcagcgccaccatgccacctccgcccatc
ccgtcttaccctccccacctcccacccccacctctgcccggcttctccctgcagcccccg
ccaccccctggcataccacctccgcttcctcacatggagctgcacccagagtaccctcct
ccgctgcctcatcacatgtacgactacgccagctccatggagctcatgagccagtactgc
ggaggagcacccatgtcattccagatgcagacacacatgctcagtcgcctccaccaaatg
cgaatggcctcctccaacagctctacggcaccccctggagaagtcccgcccgcctctgaa
tatcccccgtcatttcacctccattcaataccccctccgccgcaccacccacaccaccca
tacatggaccaagatgggaatgttgccacccactatgaccaggaccaccgctacatccct
cctcacttaccatacgcctacccggaccctcacgccgcacagcttccacaccatcacacc
atcccgcctccccacagtccctggcctcctcacctactgccccaacagtttccttcccac
tatcctccgcctggctttggcacggtgcctggcgtagacggagagctgtacggagcggcg
ggtgaccagatggccataatgggccacaacccctacgaggccgtagtgcagcaggtactg
gcagctttgatcgaggagatgaagaacatcatgcagagggacctgaaccgcaagatggtg
gagaacatcgcctttggcaccttcgacgagtggtgggaccgcaaggaacagaaagccaag
ccattccagacagccatgcggggagttgcagtggtgcgcgaggaggacaagaaggacgag
aagaccagcaaccgacctcgggagccactcatgtctctggtagactgggccaagagtgga
ggcatggagggtttatcccttcggggggccttgcgtttgccttcttttaaggtgaagagg
aaggagcctcaggaacttgtggagggtggtgagctgaagagagccaggccttccactcca
cccgatgaggaagatgaggactcatatcagggcaaatctgccgacactgctgcaggaaga
acagaagagaggcgtgtggcagagagaagagcagccaggagaagaagcagagcaaaggca
cgcaaaccatatgacctggacagtgagggagaagaaacatcagatggttcctcctcagag
aaggaggaggatgaagacagtgacaaagtggatgattcagaaggtatgcagctgtcttgt
tttgtcttttgtaccaagctcattaatttgggctgttgttgctatgtgcactttattttg
ggcttttatgtgtctattgtgaagttcactttattctttctttcactaccagaagaagag
aaaacggctacagctgtgcctccatcttctccgtatccccgtcctccttcacccattctc
ctccttcccccactcaagaaacggcgcaagactgtttctttctccgtggaagagagcgag
ttcaagccctccattctgtcaccttctgctccctctctatctcccactcctgtctcacaa
gcttcagatattcctacttcctcttctcccgtaagcacacccacagcagctgcctcagcc
ggcgcctccaagcccaccccgatgctcctaccgtttgcttctcgtcctaatgagagtaac
gccctgacctcccctgcttccccttctgccgttcttaccgtccctccaccggtgcgttcc
ctgcggcctgatgagcccaaaaagagtccaggtctccctccatccccacaaactcccaca
gccaaaaactcctccaaacgtggcaaagactctcccagaacgcccccaacgcccgtctgc
ctcactgtccagaaccttccactggaccatgcctccttggtcaaagtggcctacgaggac
cccatccctactccaaccacgcagaagggtcgcgcacgtggtcgcactcggacactcagc
cagtcggcttcctcccctcacctgcatcccgctctggaggaagaggaggaggatgaagag
gagctggagcagcggctgaagctcagggagcagctgggagtgtccagcctgctgcagctg
gcctctgcccccaaacctgatctatctgtgctggctgatgtggcactgaagatggacccg
gaggcagatatcgactcggaagaaacagagacctccgatgaggcagaggagcacaagctg
gaggaagaagagggagacttcttcgccccacacccacgccaaccactcccggatccagag
ggtctgttcgtcctgcaggagcacaactattctaaaactgctcctgctcctccgcacctc
acgtctccacaaaagagaacgaaacaggaccccacggtcctgctccctgccgacctcaac
cagcatggtgttcaggaagcccccgaagaggtcatcggggatgctctagccgcaagagga
gaggctccagagctatacgaggacttttccgggatgggcctgctgtgcgacgccagggac
acagctgagacgcagaccaagaccctcggcccacaacacaagaggagaggatcgattagc
aaagagatggagatggaagagagggggaaagggaagagcaagaagagaagtaggaaggac
aaangaaacgaggaactggaaatctctaagaaacagaaggagaaacagatcaagaagcag
aggaaacggaagttagaggaatatgaagaagatgtggatgtggaacagttggagtctggt
gagctttccagctccagctctgaatcgggagactctgactttggtctggagagatcgctg
gagtttgaaaaggaagaggttcgaaagagcgaacgacttttcctgcaggaagcaggcttg
accccctcgacccagcgacggtccaaacacgtgcccaccccagctcccgtaccacagccc
tcttacaagaaccgtagcgagtttgagcagatgaccatcctgtatgacatctggaactct
ggcctggaccaggaagatatgaggctcctgaagagcacctacgagaaactgttgcaggat
gatcacgccaccgactggctcaatgacacacactgggtccctcataccatcaccaacatc
cccaaccctcggcggaagaagaagaccgcagatgggcagctaagacagcatgtcacgggc
tgtgctcgtagtgaaggctactatgccatcagccgcaaggagaaagacgtctaccttgag
ctagaccagccagtgactgtgcaggaagctggggaatatgatacctcaggctcgaatcgt
cagctctctgaaaggcgctctgagcagcggcgtctcctcagtgctattggcactccagca
gtgatggactcggacctgttgaaactgaaccagctgaagttccgtaagaagaagctgagg
tttggccgcagccgtatccacgaatggggcctgtttgccatggaacccattgctgcagat
gagatggtcattgaatatgtgggacagagtatcagacagatggctgctgataatcgggag
aagcgatatgcccaagaaggcatcgggagcagctacctattccgtgtcgatcatgacact
atcattgacgccaccaagtgtggcaacttggctcggtttattaaccactgctgcacgccc
aactgctacgccaaagtgatcaccatcgagtcccagaagaagatagtcatatactccaag
cagcccatcggtgtgaacgaggagatcacatatgattacaagttccccattgaagagaac
aaaatcccatgtctgtgtggcacggagaactgcagaggaaccctcaactga

DBGET integrated database retrieval system