KEGG   Cyprinus carpio (common carp): 109085861Help
Entry
109085861         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 2B-like
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109085861
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109085861
Transcription factors [BR:ccar03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    109085861
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109085861
   HMT complexes
    MLL3/MLL4 complex
     109085861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Guanylate_cyc FYRC FYRN PHD zf-HC5HC2H_2 zf-HC5HC2H Bromodomain PHD_2
Motif
Other DBs
NCBI-GeneID: 109085861
NCBI-ProteinID: XP_018955901
LinkDB All DBs
Position
Unknown
AA seq 1990 aa AA seqDB search
MRVGVHSGNVLCGVIGLRKWQFDVWSHDVTLANHMESGGLPGRVHITEATLKHLNKAYEV
EEGNGHLRDTYLKELNVKTYLVIDPREDCHIQNVWLMGGLSILTSVPIMPQFVCLLCASK
GQHDMIYCQMCCEPFHHFCLPPDDRPKEENKENWCCRRCKFCHVCGRKSKQAKPVLQCKR
CMYCYHPSCLGPTYPKPVKMNTSWICMLCIRCKSCGVTPGKSSDTSWNHELELCPDCSKL
AALMRNFCTVCLKCYEEHEFDSSMMQCARCAHWVHPKCEGLTDDLYEILCRLRGKSLVFS
CAPCSKRFRSGWQDVVQEVLRSGLEKIMNGLKSSPTISHLLMCAQCEVCPDFEVVKERSG
CCLHPVEQKLENGLYTSLKAFHEDVVAVMVERLRKEYLLEEQRPTGQAKLYYIKLVEQVF
SWFNSQDPKTWNCHMQEYPSDMLPDAIIPPSDEHSYAQWLKEQDPENPQSESQDLQNVNS
QFFMDERQCSLCQQHGDAKPNDAGRLLYIGQNEWAHVNCCMWSAEVKDVKGALLHVHSAV
TRGRLMRCERCGQTGATVGCCLTSCQSNYHFMCARASNCVFQCDKKVYCYKHRDLINNKI
EQGNGFEVLRRVYVDFDGISLRRKFLTGLEPESVNVMIGSLHVQKLGVLTELSANSGKLY
PVGYQCSRWYWSTVDPRRRCRYTCKVTEVRPSTRCKAPSSMMDQGEKSHNCTQSKSSQWC
VYYSYLCLIDEDGTDSESFSPGLPPSTPSKTKQDSGAGGKTPGYPHSRRPAGGMSRPLPS
PGNAVSTSHHILTISDLDETRRATRRLSTRSRNASPPPVVLSGSMALRSGGTINPRSLSF
SPPVSPLGTTENFMSSTSPRRRGRPSSLSPSSITSGPSPPQAALRSPSSTLHSSVRHSPR
HKQPFKTTQHKTDEVVQEFFALSEPEEAADAPSHRIPASSDKSNQELLSAHFDPDTDVAV
ASVLNAKLEFDEALLNENVALDCDPQGGEGDAEEGACKFSTGTKDLTSEMQMETDDDVPD
HYLNFSRTVVVHEPAKESAQAGLSVLPNSGSISQLDGADNDSESDTGEANADDDTQEVGS
SFCSQDTEPLKCTGPNKGRTLGDGQLVCPRSPITNPHTTDSVDQNSQLETQNMDQVCEEQ
EIQEITSLQDGGNAIIDSEVSFLDQLQATTPLLCKGSDLVTTQEEVLLENESTECLQEVF
LDDTSGNFISSVDGRVLDLTENAAGPVVATVSSPVNKDEPVLKRGLSPVEKPATAVPMSS
TRTIHLVAPAAPTKSRFVTIQPGSKPKPFHMAMPVANSLPLSLPVSVVSSSPTISVAPQG
TPLAPASVLINGFGALPKEATKGCRFAIRIATPKQVSEQSLPQSLPGTPLTPQVLLVNRA
GQILVKNPQTNTYQLTSSSSPSYTQISQIAKIIHSSNVLQRPVPKVTVIPVPQVQASLGK
TTPTRIISYSSNNGATPPTQVLIRRIPQSYSGSQIHSISPSIERTGLISESGQKAVAQEI
INKAMASHREIASPTDMSPSQLHLEKCLSPESKDSFPEVHLQTQPNILSHSRPQVKIKRV
SSVTDRIGVKRCRTDFLDQMGPCSQGDNSRSNRVRIKAPSLKDVLDFDDPDVGSLDQPKN
DENKRITPNESEPTSVQVNNTRDSAKSQCMSYKPGDSSDWAPYAGWSSDEDSPSTGKQDK
CASHYLPHLRFQITSEDGFSVEADSMDVAWKAVMDGVQEARVGCRLEQFPFNRISGARVL
GVLHDAVLFLLEQLQGASLCQKHSFRFHQHEVPEEELPINPSGCARAEVYVRKSTFDMFN
FLASQHRQLPESRPCDDEEDDVMLKSSRRATSTELPMAMRFRHLEKTSKEAVGVYRSAIQ
GRGLFCKRNIEAGEMVIEYAGNVIRAVLTDKREKYYDSKGIGCYMFRIDDFDVVDATMHG
NAARFINHSCDPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDANNKLHCNC
GARRCRRFLN
NT seq 5973 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaggtgtgcactctggaaatgtcctctgtggtgtgattggcctacgcaaatgg
cagtttgatgtgtggtcacatgatgtcaccttagccaatcatatggagtcaggtggatta
ccaggacgagttcacatcacagaggcgactctgaagcacttgaacaaagcatatgaggta
gaggaggggaatggtcacctgagagacacctaccttaaagagcttaacgtcaagacgtac
ctggttatagacccgcgggaagactgtcacatccagaatgtgtggttgatgggaggattg
agtattctcacttcagtccccatcatgccccagtttgtgtgtctgctctgtgccagcaaa
ggccagcatgatatgatctactgtcagatgtgctgtgagccttttcaccatttctgcttg
ccaccagacgaccgtccaaaggaggagaacaaggagaactggtgctgccgacgctgcaag
ttctgccatgtttgtggccgcaagagcaagcaagcaaagccagttttgcagtgcaagaga
tgcatgtactgctaccatccatcctgtttaggaccaacgtatcccaaacctgtcaaaatg
aacacctcatggatttgtatgctgtgtattaggtgtaagagctgtggtgtgacacctggg
aagtcctcggacacgtcctggaaccatgagctggaactctgccctgactgtagcaaactc
gcagccttgatgaggaacttctgcactgtgtgtctgaagtgctacgaggaacatgagttt
gacagcagcatgatgcagtgtgcccgatgtgcccactgggtccatcccaaatgtgagggg
ctcacagatgatctgtatgagatcctgtgtcgactgcgggggaagagtctggtgttctcc
tgtgctccctgcagtaagaggttccgcagcggttggcaggacgttgttcaggaagttttg
aggagcggtctggagaaaatcatgaatggattgaagagttctccaaccatcagccacctc
ctcatgtgtgcacagtgtgaggtgtgtccagattttgaggttgtaaaggagcggtcaggc
tgttgtctgcatcctgtagagcagaagctggagaatggcctgtacacttcactgaaagca
tttcacgaggatgtggtggcagtaatggtggaacggctgagaaaagaatatcttctagag
gagcaaaggcccactggtcaagccaaattgtattatataaagctagtagaacaagtattt
agctggtttaacagtcaggaccccaaaacatggaactgtcatatgcaagaatatccaagc
gatatgctccctgatgccataattccccccagcgatgaacacagttatgcacaatggctc
aaagagcaggatccagaaaaccctcaatcagaatctcaagatctgcagaatgtgaactct
cagttcttcatggatgaaagacagtgctccctctgccagcaacatggagatgccaaaccg
aatgatgctggtaggctgctgtatattggacagaatgaatgggctcatgtgaactgctgc
atgtggtcggcagaggtgaaggatgtcaaaggagctttgctgcatgtccacagtgctgtc
accaggggccgcctcatgcgctgtgagcgttgtggccagacaggggcgactgtgggctgt
tgtcttacctcgtgtcagagtaactaccacttcatgtgtgctcgtgccagcaactgtgtc
ttccagtgtgataagaaagtgtactgttacaaacatcgtgacctcataaacaataagatt
gaacaaggcaatgggtttgaagttctcagaagggtctacgtagattttgatggaattagt
ctgcgtaggaagtttttaacaggcttggagccagagtctgtaaatgtaatgattgggtct
ctacatgtacaaaaattaggtgttctgacggagctgtctgcaaattctggaaaattgtat
ccagttggttaccaatgttctagatggtattggagcaccgttgaccctcgcaggcgatgc
cggtacacttgtaaagtgacagaggtgcgaccatcaacacgatgcaaagctcctagctcc
atgatggatcagggagaaaaatcacacaattgtacacagtccaaaagctcacaatggtgt
gtatactactcatatctctgtcttatagatgaggatggcacagatagcgagtccttttca
cctgggctgccccccagcaccccctccaagaccaaacaagactcaggggccggaggcaag
actcctggctatccacacagcaggagaccagcagggggaatgtccagacccttaccatca
ccaggaaatgctgtttccacatcccatcacattttgaccattagtgaccttgatgagaca
cgacgtgcaacaaggagactttccacacgtagccgaaatgcctctcctccccctgtggta
ctgtcaggctcaatggctttgcgatcagggggcacgattaaccctaggtcgctttcattc
agcccccctgtctcaccacttggtacaaccgagaacttcatgagctccacctcacctcga
cgaagggggaggccttcctctttgtctccctctagcatcacctcaggaccctctcctcca
caagcagctctacgaagtccctcttccaccttgcattcatctgtccgccactccccaaga
cataaacagcctttcaaaaccacacagcataagactgatgaggtggttcaagagttcttt
gccttgtcggagccggaggaggctgcagacgcaccaagccacagaattcctgcctcatcc
gacaagtcgaatcaagaactgctctctgcgcactttgatccagacacagatgtggcagtg
gcctcggtattgaatgcaaagcttgaatttgatgaggctttgctcaatgaaaatgtggct
ctggactgcgaccctcaaggtggtgagggagatgcagaagaaggagcctgcaaattcagc
actggcacgaaggacttgacttcagagatgcaaatggaaacagatgatgatgtccctgac
cattatctgaatttctctcgcacagttgtggtccatgaacctgctaaagaatctgcacag
gcaggtctctcagtccttcctaactcagggtccatatcacagctggatggagctgacaat
gactcggagagtgatacaggtgaagccaatgcagatgatgatactcaggaagtaggaagt
agtttttgtagtcaggatactgagccattaaaatgcactggtccaaacaagggcagaacc
cttggcgacgggcagctagtttgcccaagatcacctattacaaatccacatacaacagat
tctgttgatcagaattcacagctagagactcaaaacatggaccaagtctgtgaagaacag
gaaattcaggaaataacttctttacaagatggtggaaacgcaattattgattctgaagtg
tcatttctagatcaactacaagcaacaacacccctcctttgcaaaggcagtgatcttgtt
acgacccaagaagaagtcttgctcgaaaatgaatcaacagaatgtttgcaggaagtgttc
ttggatgacaccagtgggaatttcatatcttctgttgatggcagagttctggacttgaca
gaaaatgctgctggtcctgtggtggcaactgtttcctcaccagtaaacaaggatgaacct
gttttaaagagaggtttgtcacctgttgagaaaccggcaaccgctgtgccaatgagtagt
actagaacaattcatcttgttgcaccagctgcacccacaaaaagtcgatttgtgaccata
caacctggctccaaacccaaacccttccatatggcaatgcctgttgccaactctctacca
ctttccttgcctgtcagtgttgtctcatcttctcccaccatttctgttgcaccacaagga
actccgcttgctcctgcttcagttttaataaatggttttggagctctgcctaaggaagcc
actaagggttgtaggttcgccatacgcattgccaccccaaaacaagtgtctgaacagtcc
ctgccccagagtttacctggtacaccccttacacctcaggttcttctggtcaaccgtgcc
ggacagattctagtgaaaaacccgcagaccaatacataccaattaactagctctagttct
ccctcgtacacccaaatcagccagattgcaaagataatccacagcagtaatgttctccag
cgacctgtccctaaggttacggtgataccagtgccgcaggttcaggctagtctcggcaaa
accacaccaacgcgtatcatatcttacagcagcaacaacggagcaacaccaccaacccag
gtgctaatcaggaggattcctcagagttattctggaagccaaatacacagcatcagtccg
tcgatagaaagaactggcttgatttctgaaagtgggcagaaggcagtggcccaggagata
atcaacaaagcaatggcaagtcaccgtgaaatagcaagtcccactgacatgagcccttct
cagctccacctcgaaaaatgcctctctcctgaatcaaaggattcattccctgaggtacat
cttcagactcaacccaacatcttgtcccactccagacctcaagtcaagatcaagagagtg
tcttcagtaactgatcgaattggtgtgaaaagatgccgtacagacttcttggaccagatg
ggtccttgttcccagggtgacaacagcagatcaaaccgggttagaataaaggccccaagt
ttaaaggatgtgctcgactttgacgaccctgatgttggatctcttgaccagccaaagaac
gatgaaaataagagaattactccaaatgaatcagagcccacttcagtgcaggtaaataac
acacgggacagtgctaaatctcagtgtatgagctacaaacctggtgattcctcagactgg
gccccctatgcaggttggagttcagatgaggactctccatcaacaggcaagcaggataag
tgtgccagtcattatctgccccacctgcgcttccagattaccagtgaggatggctttagc
gtagaagctgacagcatggatgtggcgtggaaggcagtaatggatggtgtccaggaggca
cgggtaggctgtcggctagagcagtttcccttcaacaggataagcggcgccagggttctg
ggtgtcctccacgatgctgtgctctttctgctggagcagctgcagggtgcttctctctgc
cagaaacacagttttcgtttccaccagcatgaagtaccggaagaagagctgccaataaac
cccagtggctgtgctcgcgcagaggtctatgtgcgaaaatctacctttgatatgttcaat
ttcctggcatcgcaacatcgtcaacttcctgagtcaaggccatgtgatgatgaagaggat
gatgttatgctaaaatccagcagacgagccacaagtacggagttgccaatggctatgagg
ttcagacacttggagaaaacctctaaagaggctgtgggagtttacagatctgctatacaa
ggtcgtggtcttttctgcaagaggaacattgaggctggagagatggtgatcgagtacgct
ggcaacgtcatccgtgcagttctcactgacaaaagggagaaatactatgacagcaagggc
atcggctgctacatgtttcgcattgacgattttgatgtggtggacgccaccatgcacggg
aacgcggcacgatttataaatcactcctgcgaccctaactgttactcaagagtcatcaat
gtggagggccagaaacacatcgttatattcgccctgcggaagatttaccgtggagaagag
cttacctatgactacaagttccccattgaagatgcaaacaacaagttgcactgtaactgc
ggggcccggcgctgccggcgcttcctgaactaa

DBGET integrated database retrieval system