KEGG   Cyprinus carpio (common carp): 109088593Help
Entry
109088593         CDS       T05134                                 

Definition
(RefSeq) N-lysine methyltransferase KMT5A-A-like
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109088593
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109088593
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109088593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TrbM
Motif
Other DBs
NCBI-GeneID: 109088593
NCBI-ProteinID: XP_018958303
LinkDB All DBs
Position
Unknown
AA seq 286 aa AA seqDB search
MNGDIICNGHSPFHRLLQHSSSKSQHHEAIAVKLIQDGKTSRLFCTQNEPQKHGDSRRGS
TVNGEFILPKMAVNEELQHSVHRAEEKMHQLHCTASYIHASSDITSPSQRKRACRKVKVK
KATQRIMPVFCHQCEEKRHIDMLITNGIENGMMVRYIEGKGRGVFATQKFQKGQYVVEYH
GDLLQITDAKKREALYAQDPTTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQ
TKLHDINGIPHLILVASRDIQEGEELLYDYGDRSKASIEAHPWLKH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggacatcatatgcaacggacactctccatttcaccgtctcttgcagcacagc
agctccaaatcacagcatcatgaagccatcgctgtcaaactcatccaggacgggaaaacc
tcacgattattctgcacacaaaatgagccacagaagcatggagattccaggagaggcagt
accgtgaatggtgagttcatcctcccaaaaatggctgtgaatgaagagctgcagcactca
gtgcacagagctgaggagaaaatgcatcagctgcactgcactgcgtcatacatccacgcc
agcagtgacatcacttcccccagtcagaggaaacgagcctgtcgcaaagttaaagtaaag
aaagccacacagagaattatgcctgttttctgtcaccagtgtgaagagaagaggcacata
gacatgctgatcacaaacgggattgagaatggaatgatggtcagatacattgaaggaaag
ggcaggggagttttcgccacccagaagttccagaaaggccagtatgtagtggagtatcac
ggagatctgctgcagataacggacgccaaaaaaagggaggctttatacgcacaagaccca
accactggctgctacatgtattacttccagtatctcagcaaaacatattgtgtggacgct
acgaaggagtcggatcgattgggaaggctcatcaaccacagtaaaaacggcaattgtcaa
accaaactccatgatattaatggaatacctcaccttatcctcgtggcctccagagacatc
caggaaggagaagaacttctttacgactatggcgaccgcagtaaagcttcgatagaagct
catccatggctaaagcattaa

DBGET integrated database retrieval system