KEGG   Cyprinus carpio (common carp): 109105279Help
Entry
109105279         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETDB1-B-like
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109105279
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109105279
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109105279
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109105279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pre-SET SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 109105279
NCBI-ProteinID: XP_018974167
LinkDB All DBs
Position
31
AA seq 1115 aa AA seqDB search
MEVDASLASEMELDPELEEELGVSLDELRSWIEEQVDSSEAVRQRKDQLEQLQEWVEQRE
KEVVDMDALCSNASESVVQCEALVKEVYSKMGLVYHESSSEDEGGGKANTSEVIEIDDDD
DDDVIAVGCVVPPKKVVTPGKDPAFKEASAALQRTSQQVQNLAQSVNRTAPSSLTPAKAV
SPPTQSHGALAVPAVFMSSGPRNAPTQPNPNIKQDNIKINMTLLGKKRTKTWHRGTLVAI
KQVGNNFKYKVKFENKGKSLLSGNHVAFDYHPTLERLFVGARVVARYKDGNQVWLYAGVV
AEMPNSKNRMRFLIFFDDGYASYVGLPELYPICRPLKKTWEDIEDASCRDFIEEYITSYP
NRPMVLLKPGQIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMFNL
KMNTASSQEKKMAGQQRQRPNMGALRTKGPVVQYTSDNSASASSRPAAPQIPPPRPMPAG
PPQPSRTESPSLKSQMAKKSTGPVALQPRQAIASDIQPKALIGTIHQTNTSRLFLLQSGP
VHTLTPITPSSALICDNLVSTFTSERIPQEPSYQAPNDRLFLPYTQLAHLCLKRIRPTHP
NLHRGRNPLLTPLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMAEIQRYLFQTHCD
FIFLEMFCLDPYVLVDRRFQPQRPFYFIRDIPGGREDIPLSCVNEIDSTPPPSVAYSKER
IPADGVFINTSSDFLVGCDCTDGCRDKSKCSCHQLTLQATGCAPGGQINPNAGYHHKRLE
ECLPTGIYECNKRCRCNPQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVCI
YAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRVKL
PASSQHGKSTIKMEERNSSTTGKSQDDSSENSDDDKDEESNEDESDSSDDTFVKDTYYST
SSVWRSYTTRRQAKGMKEESQDSKDGLNASTGEERKPPPMPEETGKSKVASWLTSQSSTS
ANQSVKVEGGIKTEKKDVMTLLFYFYFVLFNYLGYRSMPSQNIYRLCGLYIKLCFYRRIR
AGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggatgccagtctggcctcagagatggagttggatccagagttggaggaggag
ttaggggtgtctttggacgagctgcgcagttggatcgaggagcaggtggacagcagcgag
gccgtgcggcagaggaaagatcagctggagcagctgcaggaatgggtggagcagagggag
aaggaggttgttgatatggatgctctttgttctaatgcttcagagtctgtggttcagtgt
gaagctctggtgaaggaagtgtacagtaagatgggtctggtgtatcatgagagcagctca
gaggatgagggaggaggcaaggcaaacacttctgaggtcattgagattgacgatgatgat
gacgacgatgtcattgctgtgggatgtgtggttcctcccaagaaggttgtaactccaggg
aaggacccagcgtttaaggaggcttcagctgctcttcaaagaacatctcagcaggtgcag
aacctggcccagtctgtcaacagaacagccccctcgagtttgacaccagctaaagcagtg
tcccctcccacacaatcccatggtgcactagctgttccagcagtgtttatgtcctcaggt
ccaaggaacgcacccactcaaccaaaccctaatataaaacaggataatatcaagatcaac
atgacacttttaggtaaaaaacgaaccaagacgtggcatcgtggaacacttgttgccatc
aaacaagtggggaacaattttaagtacaaggtgaagtttgagaataaagggaagagtctt
ctctctgggaaccacgtggcatttgattaccacccaacactggagaggctgtttgttggt
gcccgtgttgtcgccaggtacaaggatggcaatcaagtctggctctatgcaggcgtagtt
gctgagatgcccaacagcaagaaccgtatgaggttcctaatttttttcgatgatggttat
gcctcatatgtgggcctgcctgagctgtacccgatctgcagaccattaaaaaagacctgg
gaggatattgaggatgcatcatgcagagatttcattgaggagtacatcacatcatatccc
aacagacccatggtgctgctgaagccagggcagatcataaagacggaatgggagggaaca
tggtggaaaagccgtgtggaagaagtggatggcagtcttgtcaaaatgcttttcctggat
gataagcggagtgagtggatttatcgtggctcaacaagactagaacccatgtttaatctg
aaaatgaacacagctagcagtcaagagaagaaaatggctggccaacaaagacaacgtccc
aatatgggagcattgaggacaaagggccctgtagtgcagtacactagtgacaacagtgct
tctgcttccagtcggcctgcagccccacagatcccaccacctcgtccaatgcctgccgga
cccccacagccttctcgcacagagagtcctagtttaaagagtcaaatggctaaaaagagc
actggtcctgttgcactgcagcctcgtcaggccatagcctctgacattcagcccaaagca
ctaatcggcactattcaccaaacgaatacctccaggctctttcttctgcagtctggacct
gtgcatacattgacaccaatcacacccagctctgcactaatttgcgacaacctagtgtca
accttcacaagtgagcgtattcctcaggagccatcgtaccaggctccgaatgacagactc
ttcttaccttacacacaacttgcacacctctgcctaaagcgcatccggcccacccatccc
aacctgcatcgaggacgcaacccacttcttacaccattgctctacgagtttcgccgcatg
actggccgcagacgccttaaccgcaagatgtcattccatgtcatctacaagtccccgtgt
ggcttgagtctgagaaatatggcagaaatccagcgctacctcttccagacacactgtgac
ttcatcttcttggagatgttctgtctggacccctatgtgctggtggaccgtcgattccaa
ccccagaggccattctacttcattcgggacatcccaggcggtcgcgaagacattcccttg
tcctgtgtgaatgagatcgacagcactcctccgcccagtgtggcctacagtaaagagagg
atcccagcagatggagtctttattaacaccagctcagacttcctggtgggctgtgactgc
actgatggctgcagagacaaatccaagtgttcatgtcatcagctgactctgcaggctaca
gggtgtgcgccaggtgggcagatcaaccccaacgctggataccatcacaagagactggaa
gagtgcctccctacagggatctatgaatgtaataagcgctgccgctgtaatccgcagatg
tgcactaaccgtctggttcagcacggtttgcaggtccgactgcaactctttaagacccaa
aataaaggttggggcattcgttgccttgatgacgtcgccaagggctcatttgtttgtata
tatgcaggtaaaatcctgacagatgactttgccgataaagaaggtttggaaatgggtgat
gaatactttgccaatctagaccacatcgaaagcgtggagaactttaaggaaggttacgag
agtgaggcccactgctccgacagcgagggcagcggggtggacatgagcagggttaaacta
cctgcttcctcccaacacggtaaatccaccatcaagatggaggagcgtaacagcagcact
actggcaaaagtcaagacgattcatctgaaaacagtgatgatgacaaagatgaagagtct
aatgaggatgagagcgacagctccgacgacacatttgtgaaagacacatattactccacc
agctcagtgtggaggagctacaccacccgcagacaggccaagggaatgaaggaagagagt
caggacagtaaggatggactgaatgcatccacaggtgaagagaggaagccacctccaatg
ccagaggagaccgggaagagtaaagtggcatcttggctcaccagccagtcttccacttct
gcaaatcagagcgtcaaggtggagggagggataaagacggagaagaaggatgtaatgacc
cttttattttatttttattttgtactatttaactatttaggataccggtccatgcctagt
cagaatatttacagactatgcggtctttatattaagctgtgtttctacaggcgcatccga
gcagggacggagctgacgtgggattataattatgaagttggcagcgtggagggcaaggag
cttctttgctgttgtggatcaacagaatgcagaggacgactgctgtaa

DBGET integrated database retrieval system