KEGG   Clostridium cellulolyticum: Ccel_2215Help
Entry
Ccel_2215         CDS       T00835                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00500  Starch and sucrose metabolism
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ccel_2215
Enzymes [BR:cce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Ccel_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ACL76557
JGI: Ccel2215
UniProt: B8I4Q3
LinkDB All DBs
Position
2587053..2589614
Genome map
AA seq 853 aa AA seqDB search
MYLVGKINVISTLPEKFKRLNDIAYNLWWTWNPEAIDLYREIDLELWEKVDKNPVRFLQE
VSQKKLQGKLLDVEYLTRLDKVIASFDSYMSEKNTWFSQNHSELTDKNVAYFSAEYGLSE
VLPIYSGGLGVLSGDHCKSASDLGIPFTAIGLFYKQGYFSQRINKEGWQETCFNDLNISQ
LPMLPALNSNGEQVRINITFAGRTVYAIVWKVQIGRINLYLMDTDVAENSPADRSLTSRL
YGGDQETRIQQEIFLGIGGIRVLDALGIQANVYHMNEGHSSFMGLELIRKLINEKHLNFS
EAMEVVANSSIFTTHTPVPAGNDVFPLFMMDKYFGDFWGQLGLSRHDFFELGLKKPEDQN
FNMTVLALTLAGRKNGVSRLHGAVSRKIFGDVWPEVPEDDVPITYVTNGIHTLTWLSPKI
KDLYDKYLETDWKKKIYSKETFTGIDSIPDEELWATHVELKNKLITFVRDRLKKQKLANG
ESMESVRQVDSFLDPNALTIGFARRFATYKRANLIFRNLARIQKILNNPERPMQIIFAGK
AHPADGPAHDVIKNINDIAKMEGFYGKVILLENYNMTVARNLVQGVDVWMNNPRRPLEAS
GTSGQKVCINGVINFSILDGWWCEGYNGENGWVIGDESEFDNEHIQDNTDSESIYDTLEQ
NIIPLFYNVNEKGVPTEWVRIMKNSISSLAWNYSTDRMVKEYTGRMYVPAITGSSRICAD
NYSLARSMSGFRDHLNLNWPNVQLFAEKSSGDLKNYKTDSCQEIYLSSTVCLGNIDPANV
IAEVYYGTLSNGKIENAQVAEMHCDEKTGEGTYRYSINLKIDDGGEYGYTFRITPKHEYL
INRFDTGLIKWIK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtatctagtcggtaaaattaacgtaatatctaccttaccagaaaaatttaagaggttg
aatgatatcgcttataatttgtggtggacgtggaatccggaggctattgacctttataga
gaaattgatttagagctgtgggagaaggttgacaaaaaccctgtacgttttttgcaggag
gtaagccagaaaaaacttcaaggcaaacttttggatgtagaatatttaacccgtcttgat
aaagtaattgcttcctttgacagctatatgtctgaaaagaatacatggttttctcaaaat
cattcggaacttactgataaaaatgtagcatatttttcagcagaatatgggttaagcgaa
gtcctgcccatctactcaggaggtttgggtgttttgtcaggggaccattgcaagtcagca
agcgatttgggtattccatttacagcaataggactgttttataagcagggttacttcagc
cagagaataaataaagaaggttggcaggaaacctgctttaacgatcttaatatctctcag
cttcccatgttgcccgccctgaattcaaacggcgaacaggttcggataaatataaccttt
gcaggccgcactgtgtatgcaatcgtttggaaagtacagattggcaggataaacctttac
cttatggatacagatgttgctgaaaatagtcctgcagacaggtcactgacctcaagactc
tatggcggagaccaggaaacaagaatccagcaggaaatttttctcggtataggcggtata
cgtgtacttgatgctctgggcatacaggcaaatgtatatcatatgaatgaaggacattca
tccttcatgggacttgaacttataagaaaactcataaatgaaaagcatctgaatttcagt
gaggccatggaggtagtcgcaaattcctcaatatttacaacccatacccctgttccggca
ggaaatgatgtttttcctttgtttatgatggataaatacttcggagatttctgggggcag
ctgggccttagcagacatgatttttttgaactgggtcttaaaaagccggaagaccagaat
ttcaatatgactgttctggcacttacccttgcaggaaggaaaaatggtgtaagcagactt
cacggtgcagtatccagaaagatatttggtgatgtttggcctgaagtacctgaggatgac
gttcctataacctatgtaacgaatggtatccataccctcacatggctttctccgaaaatc
aaagatttgtatgacaaatatctcgaaacagattggaagaaaaagatatattcaaaggaa
acctttacaggaattgatagtattcccgacgaggaattatgggcaactcatgtagaattg
aagaataaacttataacctttgtaagagacagactgaaaaaacaaaagcttgcaaacgga
gaatcaatggaatcagtaagacaggttgacagctttctggacccaaacgccctaactata
ggatttgccagaagatttgctacctacaaacgtgccaacctgatttttagaaatctggca
aggatacaaaagatacttaataacccggaaaggccaatgcagattatttttgctggaaag
gctcacccagcagacggtcctgcccacgatgttattaagaacataaatgatattgctaaa
atggaaggcttttacggcaaggtaattcttcttgaaaactacaatatgactgtagccaga
aatttggttcaaggtgttgacgtttggatgaacaatcccagaaggccccttgaagccagc
ggtacaagcggtcagaaggtttgtataaacggagtcataaacttcagtattctggacgga
tggtggtgtgagggctataacggtgaaaacggttgggttataggcgatgaatccgaattt
gacaacgagcatattcaggacaatacagacagtgaatcaatttatgatacactagagcag
aatattatacctcttttctacaatgtaaatgaaaaaggtgttcctaccgagtgggtacgc
attatgaaaaactccataagctcccttgcgtggaattacagcactgacagaatggtaaag
gaatataccggtagaatgtacgtccctgcaataacaggaagctcaagaatttgtgccgac
aattatagtcttgccaggtccatgagcgggtttagagaccatttaaatttaaactggccg
aacgtacagctctttgcagaaaaatcctccggggacctcaaaaattacaaaaccgattca
tgtcaggaaatatacctctcatcgactgtttgcctgggcaacatagatcctgcaaatgta
attgcggaggtatactatggtactctttcaaatggtaagatagaaaatgctcaagtagca
gaaatgcattgcgatgaaaagacaggtgaaggtacctataggtattccattaatctcaaa
atagatgatggaggagaatatggctataccttccgtataacgccaaaacatgaatattta
ataaacagatttgatacagggctgataaaatggattaaataa

DBGET integrated database retrieval system