KEGG   Clostridium chauvoei: BTM20_05845Help
Entry
BTM20_05845       CDS       T05083                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cchv  Clostridium chauvoei
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cchv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BTM20_05845
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BTM20_05845
Enzymes [BR:cchv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BTM20_05845
Bacterial toxins [BR:cchv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BTM20_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1285306..1289205
Genome map
AA seq 1299 aa AA seqDB search
MCKKKIMAIIMSSLFIANLSNTIIYADINDRAYINQYEQQRGSKPISEKLVPKSEITATA
TSSQPGEGADKAIDNNTSTLWHTPWGGVDIGSNPQSLTLNLGKTRNISSIHVTPRQQGNN
GMIKEYKIYAGDKVMAEGTWKTDASTKYVIFNEPVSTDNIRIEAISTAGDTNNKYASIAE
VEVYEASNSEIVKLVEASNKVINSGNGGSYEGNIDEVKTLEEGTAIIRFINKGSGIQSLF
SISNNTRANEHFHVYLNGGTIGYELRKQSGNLSTGTVNKALNAGINTLAFRAEKNTGYSI
YLNGEKILDKAVTSATFLSTLEGLNTLSLGKTDRASGSNEYNFTGEIDFFELYSQPLADR
YLKEITGETTAKELPLPEGVLKTEPIDLFAPGELDSNNFRIPALYTTKNGNVLASIDVRK
GGGHDSPNNIDTGIKRSIDGGVTWDEGKVILDYPGASSAIDTSMIQDEETGRIFLLVTHF
AEGYGFPNSTTGSGYVEIEGQRYLKLLGANNSIYTVRENGIVYDSNGEATNYKVDEQNEL
YENETRVGNILLSNSPLKVMGTSFLSLIYSDDEGETWSDPIDLNKQVKSDWMRFLGTGPG
RGHQIKTGNYAGRLVFPVYLTNSSGFQSSTVIYSDDNGATWNMGETATDGRLMSNGEKAN
AETITTSTSGGVGQLTECQVVEMPNGQLKMFMRNTGGNSSYVRIATSFDGGATWDDDVVR
DENIREPYCQLSVINYSQKIDGKDALIFANPDAGNRSNGTVRIGLITENGNYDNGEPRYD
IEWKYSKVVAPGTYAYSCLSEMPNGEIGLFYEGTGSQEMSFTRMNVDYLKSDLLQDAPAA
NIISYKTTSENYNPGDKINLNITFDQAVSLIGDRTLTLDIGGKDVTLTLVGKESGSEYSF
EGTIPSDIKGGKYGITLKGKTGLKVVNIIDKVTNISEDKDTGLTIQIGQDVVEVDKSALQ
DVINTTTNLNKEDYTEESWRVYEDALNNGKLVLAKEDATQEEVNNAKTTLESAIDSLVKK
ENQEIEKRHLKIAIDYAEKLNQDGGLEGVVPVVVDKFHKELKEAKEVYENINATTEEVDL
AFDELMKVIHMLEFKQGDKTELRNMIDKIEALDKNLYIPSTWTKLEGSLENSNKVLSNEN
TMEEEVKETFEELVRAYAEIRLKPNRDALNELIKDTESRDSSKYTEKTWKVVEVALLKAK
EVSNNEEATAREVKEAEKELRGAVDKLIAKDNGNGGSSSGGGSSSNGASSNNTTTSGKNN
TSIGKGKTLPRTGGVPAAAIGLFGVVTTAVGTIISKKKK
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaagaagattatggctattataatgtctagcttatttattgcaaacttatcg
aatactataatttatgctgatatcaatgatagggcatacattaatcagtatgaacagcaa
cgtgggtctaaacctatttcagaaaagttagttccaaaatcggagataacagcaacagct
acttcatcacaaccaggagaaggagctgataaagcaatagacaataatacatcaactctt
tggcatacaccgtggggaggggtagatataggaagtaatcctcaaagtttaacattaaac
cttgggaaaactaggaatatttcatcaattcacgtaacaccaagacaacaggggaataac
ggaatgataaaagaatacaaaatttatgcgggagataaagtaatggcagagggaacttgg
aagacagatgcaagtactaaatatgtaatttttaatgaaccagtatcaacggataatata
agaattgaagcaatatctactgcaggagatactaacaataagtatgcaagtatagctgaa
gtagaagtatatgaagcatcaaattcagaaatagttaaattagttgaagctagcaataag
gttattaatagtggaaatggtggaagctatgaaggtaatatagatgaagttaaaacttta
gaagaaggaactgcaattattagatttattaataagggaagtggaatacaaagcttattt
agtattagtaataatactagagcaaatgaacattttcatgtttatttaaatggtggaact
attgggtatgagttaagaaagcaaagtggaaatttatctacaggaactgtaaataaagca
ttaaatgcaggtataaatactcttgcatttagagcagaaaaaaatacaggatattctatt
tatttaaatggagaaaagatattagataaagctgttacttctgctacattcttatcaaca
ttagaagggttaaatactttaagtttaggaaagacagatagagcttctggtagtaatgaa
tataattttacaggagaaatagatttctttgagttatattcacaaccattagcagatagg
tatttgaaggaaataacaggtgaaactacagcgaaagaattaccacttccagaaggtgtg
ttaaaaacagaacctatcgatttatttgcaccaggagaattagatagtaataattttaga
attccagctttatatacaactaaaaatggaaatgttttagcatctatagatgttagaaaa
ggtggaggtcatgattcacctaataatatagatacaggaataaagagaagtatagatggt
ggggtaacttgggatgaaggaaaagtaatacttgattatccaggagcatcatcagcaata
gatacatcaatgattcaagatgaagaaacaggaagaatattcttattagttactcatttt
gcagaaggatatggattccctaattctacaacaggaagtggatatgttgaaatagaagga
caaagataccttaagttattaggagctaataattctatttatacagtaagagaaaatgga
attgtatatgatagtaatggggaggctacaaactataaagtagatgagcaaaatgaactt
tatgaaaatgaaacacgtgtaggaaatattttattaagtaattctccattaaaagtaatg
ggaacatccttcttatcattaatttatagtgatgatgaaggagaaacttggagtgatcct
atagatttaaataaacaagtgaaatcagattggatgagatttttaggaacaggaccagga
agaggtcatcaaattaaaacaggaaactatgcaggaagattagtatttccagtgtattta
actaattcatcaggtttccaatcaagtacagttatatatagtgatgataatggtgctact
tggaatatgggagaaacagctactgatggtagattaatgagtaatggagaaaaagctaat
gctgaaacaataacaacatctacaagtggaggggtaggtcagttaactgagtgtcaagtt
gttgaaatgccaaatggacaattaaaaatgtttatgagaaacactggtggaaatagtagt
tatgtaagaatagctactagctttgatgggggagctacttgggatgatgatgtagtaaga
gatgaaaatataagagaaccatattgtcaactaagtgttattaattacagtcaaaaaata
gatggaaaagatgcattaatatttgcaaatcctgatgcaggaaatagaagtaatggaact
gttaggataggtttaataacagaaaatggaaattatgacaatggtgaaccacgttatgac
attgagtggaaatatagtaaagtagtagctccaggaacttatgcatattcttgtttatca
gaaatgcctaatggagaaattggattattttatgagggtacaggaagtcaagaaatgtcc
tttactagaatgaatgtggattatttaaaatctgatttgctacaagatgcaccagcagct
aatataatatcgtataaaacaactagtgaaaattataatccaggagataaaataaattta
aatataacttttgatcaagcagtatctcttataggagatagaactttaactttagatatt
ggagggaaagatgttacattaaccttagttggtaaagaaagtggtagtgaatattccttt
gaaggaacaataccatcagatataaaaggtggtaaatatggtataactctaaaaggaaaa
actggattaaaagtagttaatataatcgataaagtaactaatataagtgaggataaagat
acagggttaactatacaaattggacaagatgtagtagaggtagataaaagtgctttacaa
gatgtaataaatactacaactaatttaaataaagaagattatacagaagaaagctggagg
gtatatgaagatgctttaaacaatggtaaattagttttagcaaaggaagatgcaacccaa
gaagaagtaaacaatgctaagactacactagaaagtgcaatagatagtctagttaaaaag
gaaaatcaagaaatagaaaaaagacatcttaaaatagctatagattatgctgaaaaatta
aatcaagatggtggtcttgaaggtgtagtacctgtagttgttgataaattccataaagaa
ttaaaagaagcaaaagaagtttatgaaaatattaatgctacaactgaagaagttgattta
gcatttgatgaactaatgaaagtaattcatatgcttgaatttaagcaaggagataaaact
gaacttagaaatatgatagataagatagaagcattagataaaaatctatatataccatca
acttggactaaattagaaggttcacttgaaaattctaataaagtattaagtaatgaaaat
actatggaggaagaggtaaaagaaacctttgaggaattagttagagcttatgcggaaatc
agattaaaaccaaatagagatgctttaaatgaactaataaaagatactgaaagtcgtgac
tcaagtaaatacaccgaaaaaacatggaaggttgtagaggttgcattgttaaaagctaaa
gaagtaagtaacaatgaggaagctactgcaagggaagtaaaagaggctgaaaaagagtta
cgaggagctgttgataaacttatagctaaagataatggaaatggaggttcatcaagtggt
ggaggatcatcaagcaatggagcttcatcaaacaatactactacatcaggaaagaataat
acaagtattggaaagggtaaaacattaccaagaacaggaggagttccagctgctgcaata
ggattattcggagtagttacaacagcagtaggtactataatttctaaaaagaaaaaataa

DBGET integrated database retrieval system