KEGG   Clostridium chauvoei: BTM20_11505Help
Entry
BTM20_11505       CDS       T05083                                 

Definition
(GenBank) hypothetical protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cchv  Clostridium chauvoei
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cchv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BTM20_11505
  Lipid metabolism
   00600 Sphingolipid metabolism
    BTM20_11505
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BTM20_11505
Enzymes [BR:cchv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BTM20_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2500817..2507041)
Genome map
AA seq 2074 aa AA seqDB search
MKYKKIIATILSTLLITTSSGITTFAEIIGREGNGIVNNINKESQRKILFNDGWTFNLGD
VPAAKEKDFDDSSWRSLNLPHDWSIELDFNKNSPATHEGGFLDGGIGWYRKSFVLPPSMK
GKELTIDFEGVYMDSYVYVNGTQVGNHPYGYTPFSFNITDNLVCDGVTENVIAVKVNNRQ
PSSRWYSGSGIYRDVNLTVTNKIHVEKNGTFVTTPDLQNNYSKGKAKVNIKTDIVNKESE
NKEVKVKSVILDRDGNNIGENITTELVETGSTKKFNADVEIRNPILWSTENPYMYKVVTT
VMDGENIVDEYETDFGVRWFEFTNDNGFYLNGKQMKLEGVCMHHDQGALGAVDNRASISR
QVKKLKEMGVNSIRVTHNPASQHLIDICNEEGILLIEEAFDTWYDGKKTYDYGRFFEQKS
IHGDMTWAEFDIKQMVNRGKNAPSIIMWSLGNEIWETNQTKAVQTAQNLHDWVKEVDPTR
PTTMGEDKFRMGTGQGAHENVANIIDVVGFNYAEDNYDSLRSKHQNWNIYGSENSSAVRS
RGVYSHPEQTLSMHTHADKQQSSYDNDHVGWGKTAEEAWKRDRDRGYVAGEYIWTGFDYI
GEPTPYYNAFPAKSSYFGAIDTAGFEKDVFYFYQSQWSDKPMVHLLPHWNWEDDNSIKVD
GDKILVYAYTNANKVDLYYNSDVNSEELGELVGTDKYEVTNAGYNGTYKETNDGKLHLEF
RVQYRPGKLTAVAKDSKGKEIARDVVKTAKEAKKVNLTADRQVVEADGYDLSFITVDIVD
ENGNIVPNADNLVNFEISGNGKIVGVDNGNAASVERFKDNKRQAFNGKALVIVQSTDNAG
SFTLTATSEGLSADNITLYSVEKDDMNKTEILGYDVSDIIVPVNGELNLPEKVTALYSNG
SSGEVKVTWEEVSSDKLSKAGIFKVTGTTKDSEKPVVVNVIIKDIIGVLDSRILTPVGEI
PTLPTEVSTVYNDGGIEKNKVTWERELVQADVDAPKTIEILGTLEGIDGLKAKMIIVVSD
NYELKNIGLNEGSIYPKASTSYQGPDSVNAINDGVISKGNSPKNRWTNWGKPGGNYDDYV
TIEFDKEHSINKVGLSLYRDGGVEIPSEIIIEYFDGSNWIPVSNQSKKNGFSADGTEEIS
FDSITTNKIRALLKEDTNANKAIGLTEFEVYSNVITMEGTALLQDIKVNDVSIENFNENN
AEYIVDLPYGQEIPVVSAVAKDNASIFVIPSLTTNGTAKILVTAADGITKKTYLVKFRES
APTLESASISLDKENVVEDDIVNVLIDARLQDGNKIDRNNLDIKYNISSENGAEAKIVDN
KLYAYTAGDISLSAEVTYKGVTKTTNTININIATNTTAKKIISYEKVTVETEKGIKPVLP
EKVKATYDTGLPRDVKVTWNEVKEEDYNKYGVFEVEGTVEGQELKPTVKVLVKGISAVNN
VSMATNIGVEPKLPETVKAYYTDGTSVDMPVVWESYNKELLQTEGTFVINGTLEGLDIVA
KANVRVTSNFIKGDNIARGRNGYDLPMAIASYTNDRTVDPASQDSILKVNDDIIEHDPSR
ANNRWSNWKRSDKHESDWVGIIFGSGVVEEKYINNLEVDYFEDGGSKVPQSVTVQYYIGE
ELPLPSNQGQIGSDSNSPLNDDNNWRDVANLSVNPEETSGSATNLYTFDMVKTKALRVKM
NAKPNMALAITEIKAFEQKVVPNSDFVVNMIKVNNKDLEGFSEDRYNYTIKINKNDNLPE
IAVDTTNNASVSTVYTTNDYEKIDVIIKSEDGLKEKKYSITIEREESKEEVSKTALKIAI
DYAEDIKLNGGLEGVVPVVVKEFDDGLNLAKEVYANENATIEEVDAAFKKLMNAIHMLEF
KQGNKDELQRMVDIIIALEKDKFIETTWVKLEAELEKANKLLEDENAMQAEIDKTFDSLV
RASLELRLKPNKALLEELINKANNMDLSKYTEESVGKLKLELNEAGKVLNDKDATQEVVD
KTVENLQLALENLEEKSEPNKPEEKPENKPENKPEIKPENKPNNGNNNSNSNGTSNGSSA
GGKLPNTGGAQLGVFGLVSVLAGLGIYKKRKDNK
NT seq 6225 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaaaaaataatagctacaattttatcaacattgttaataactacatcttca
ggtataactacatttgcagaaatcattggaagagagggtaatggaatagttaacaatata
aacaaagaatctcaaagaaaaatattatttaatgatggatggacatttaatttaggtgat
gttccagctgctaaagaaaaggattttgatgacagtagttggagaagcttaaatttacct
catgattggagtatagaattagattttaataagaattctccagcaacacatgaaggagga
tttttagatggtggtatcggatggtatagaaaaagctttgtacttccaccttcaatgaaa
ggaaaagagttaacaattgattttgagggagtttacatggatagctatgtttatgtaaat
ggaactcaagtgggaaatcatccatatggatatactccattttcatttaatataacagat
aatttagtatgtgatggagttactgaaaatgttatagctgtaaaagttaataatagacag
ccaagtagtagatggtattcaggaagcggtatatatagagatgtaaatttaactgttact
aataaaattcatgtagaaaagaacggaacatttgttacaacaccagatctacaaaacaat
tattcaaaaggaaaagcaaaagttaacataaaaactgatattgtaaataaggaaagtgaa
aataaagaagtaaaagttaaatcagttatattagatagagacggaaataatattggcgaa
aatataactacagaactagtagaaacaggctcaacaaagaaatttaatgcagacgtagaa
attagaaatcctatactttggtcaactgaaaatccttatatgtacaaagtagtaactaca
gtaatggatggagaaaatattgttgatgaatatgaaactgatttcggtgtaagatggttt
gaattcacaaatgataatggattctatttaaatggtaagcaaatgaaacttgaaggtgta
tgtatgcatcatgaccaaggagctttaggagctgtagataatagagcatccataagtaga
caagttaaaaagttaaaagaaatgggagtaaactcaataagagttactcacaatccagct
tctcaacatttaatagatatatgtaatgaagaaggaatacttcttatagaagaagcattt
gatacttggtacgatggaaagaaaacttatgattatggaagattctttgaacaaaaatca
attcatggagatatgacttgggcagaatttgatataaaacaaatggtcaatagaggtaaa
aatgctccaagtataataatgtggtccttaggaaatgaaatatgggaaactaatcaaact
aaagctgttcaaacagcacaaaatttacatgattgggttaaagaagttgatccaacaaga
cctacaacaatgggagaagataaatttagaatgggtacaggacaaggagcacatgagaat
gtagctaatattatcgatgttgtaggattcaattatgctgaagacaactacgatagtctt
cgttctaaacatcaaaattggaatatatatggatcagaaaattcatctgcagtaagaagt
agaggagtttactcacatccagaacaaactttatcaatgcatacacatgcagataagcaa
caatcatcttatgataatgatcatgttggttggggaaaaacagctgaagaagcatggaag
agagacagagatagagggtatgtggctggagaatatatatggacaggttttgattatata
ggagaaccaactccatattataatgctttcccagcaaaatcatcatactttggggctata
gatacagctggttttgaaaaggatgtattctatttctatcaaagtcaatggtcagataag
ccaatggttcacttattaccacattggaattgggaagacgataatagtataaaagtagac
ggagataaaatattagtttacgcatatacaaatgctaataaagttgatttatattataac
tcagatgtaaatagtgaagaattaggcgaattagtaggaactgataaatatgaagtaact
aatgcaggatataatggaacttataaagaaacaaatgatggtaagcttcatttagaattt
agagttcaatatagaccaggtaaattaacagctgtagctaaagattcaaaaggaaaagaa
attgcaagagatgtagttaagacagcaaaagaagctaagaaagttaatttaactgcagat
agacaagttgtagaagctgatggatatgatctttcctttataactgtagatatagttgat
gaaaatggaaatatagtacctaatgcagataatctagttaactttgaaatttcaggcaac
ggaaaaatagttggtgttgataatggaaatgcagctagtgtagaaagatttaaagataat
aaaagacaagcttttaatggaaaagctttagttatagttcaatctactgataatgcaggt
tcatttacgttaactgcaacaagtgaaggactttcagcagataatataactctttattca
gttgaaaaagatgatatgaataaaacagaaatattaggatatgatgttagtgatattatt
gtaccagttaatggagaattaaatcttccagagaaagttacagcattatatagcaacgga
agtagtggagaggtaaaagttacttgggaggaagtttcaagtgataagttatctaaagca
ggtatatttaaagttactgggactactaaagatagtgaaaagccagtagtagttaatgta
attattaaagatattataggtgtattagattcaagaatcttaacaccagttggagaaata
ccaacacttccaacagaggtatcaactgtttataatgatggtggtatcgaaaagaataaa
gtaacatgggaaagagaattagtacaagctgatgtagatgcacctaaaactattgaaatt
ttaggaacattagaaggtattgatggccttaaagcaaaaatgataatagtagtttctgat
aactatgaacttaaaaatataggattaaatgaaggtagtatttacccaaaagcaagtaca
tcatatcaaggtcctgatagtgtaaatgctataaatgatggagtaatttctaaaggtaat
tctcctaagaatagatggacaaactggggaaaaccaggtggaaattatgatgattatgta
acaatagaatttgataaagaacattcaattaataaagtaggattatccttatatagagat
ggtggagtagaaattccaagtgaaatcataatagaatattttgatggatcaaattggatt
ccagtatcaaaccaaagtaagaaaaatggattctcagctgatggaacagaagaaataagc
tttgattcaataacaacaaataaaataagagctttattaaaagaagatacaaatgcaaat
aaagctattggacttactgaatttgaagtttattcaaatgttataactatggaaggaact
gcattattacaagatataaaagttaatgatgtatctatagaaaactttaatgaaaataat
gctgagtatatagtagatcttccatatggacaagaaattcctgttgtttcagcagtagct
aaggataatgcaagtatatttgtaataccatcacttactacaaatggaacagcaaaaatt
ctagtaacagcagcggatggaataacaaagaaaacttatttagttaaatttagagaaagt
gcaccaactttagaaagtgcaagtatttctttagataaggaaaatgtagtagaagatgat
atagttaatgttttaattgatgctagattacaagatggaaataaaattgatagaaataat
ttagatattaaatataatatatcatcagaaaatggagcagaagctaaaatagttgacaat
aagctttatgcatatacagctggagatataagtttatctgcagaagtaacttataaagga
gttacaaaaacaacaaatactattaatataaatattgcaacaaatactacagctaagaag
ataatttcttatgaaaaggtaacagttgaaacagaaaagggaataaaaccagtattgcct
gaaaaggtaaaagcaacttatgatactggattaccaagagatgttaaagttacttggaat
gaagttaaagaagaagattataacaagtatggagtatttgaagtagaaggtactgttgag
ggacaagaattaaaaccaactgtaaaagtattagtaaaaggaatatcagcagtaaacaat
gtttctatggcaactaatataggagtagaacctaagcttccagaaactgttaaagcatat
tatacagatggtacaagtgtagatatgccagtagtttgggaatcatacaataaagagtta
ttacaaacagaaggaacattcgttataaatggaactttagaaggtttagatattgtagct
aaagcaaatgttagagttacatcaaactttataaaaggagacaatatagctagaggaaga
aatggttatgatttaccaatggctatagcatcatatactaatgatagaacagttgatcca
gcatcacaagatagcattttaaaggttaatgatgacataattgaacatgatccaagtaga
gctaataatagatggtcaaattggaagagatcagataaacatgaaagcgattgggttgga
attatatttggatctggagttgttgaagaaaaatatataaataatttagaagttgattat
tttgaagatgggggctcaaaggttcctcaaagtgtaacagttcaatattatattggagaa
gagttaccattaccatcaaatcaaggtcaaattggaagtgattctaattcgcctttaaat
gatgataataattggagagatgtagctaatttaagtgttaatccagaagaaacatcagga
tcagcaacaaatttatatacttttgatatggttaaaacaaaggctttaagagtaaaaatg
aatgctaaaccaaacatggcattagcaataactgaaattaaagcatttgaacaaaaagta
gttccaaattcagattttgttgtaaatatgattaaggtaaataacaaagacttagaagga
tttagtgaagatagatataattacacaataaaaataaataaaaatgacaatttaccagaa
atagctgtagatacaactaataatgcatcagtttcaacagtatatactacaaatgattat
gaaaaaattgatgtaattattaagtcagaagatggtttaaaagaaaagaaatactcaata
acaatagagagagaagagagtaaagaagaagtaagtaaaactgctttaaagatagctata
gattatgcagaagatattaagttaaatggtggtcttgaaggggtagttccagtagtagtt
aaggaatttgatgacggtttaaatttagctaaggaagtttatgcaaatgagaatgcaact
atagaagaagtagatgcagcctttaagaaattaatgaatgcaattcatatgcttgaattt
aagcaaggaaataaagatgaacttcaaagaatggtagatataataattgctttagagaaa
gataaatttatagaaacaacttgggttaaattagaagcagagcttgaaaaggcaaataaa
ttattagaagatgaaaatgctatgcaagcagaaattgataaaacttttgactcattagta
agagcttctcttgaattaagattaaagcctaataaagctttattagaagagttaataaat
aaagctaataatatggatttatcaaaatacacagaagaaagtgtaggaaagcttaaactt
gagttaaatgaggcgggtaaagttttaaatgataaagatgcaactcaagaagttgtagat
aagactgttgagaatttacaattagcattagaaaatttagaagaaaagtcagaaccaaat
aagccagaagaaaaaccagaaaacaaaccagaaaacaaaccagaaattaaaccagaaaat
aagccgaataacggaaacaataattcaaatagcaatggaacttcaaatggttcaagtgca
ggtggaaagctacctaatacaggaggagctcaattgggtgtatttggattagtatcagtt
ttagctggtttaggaatttacaaaaagagaaaagataataaataa

DBGET integrated database retrieval system