KEGG   Coprinopsis cinerea: CC1G_10283Help
Entry
CC1G_10283        CDS       T01275                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
cci  Coprinopsis cinerea
Pathway
cci00010  Glycolysis / Gluconeogenesis
cci00230  Purine metabolism
cci00620  Pyruvate metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
cci01230  Biosynthesis of amino acids
Module
cci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cci_M00002  Glycolysis, core module involving three-carbon compounds
cci_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cci_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_10283
   00620 Pyruvate metabolism
    CC1G_10283
  Nucleotide metabolism
   00230 Purine metabolism
    CC1G_10283
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     CC1G_10283
Membrane trafficking [BR:cci04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CC1G_10283
Exosome [BR:cci04147]
 Exosomal proteins
  Proteins found in most exosomes
   CC1G_10283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-GeneID: 6005037
NCBI-ProteinID: XP_001828612
UniProt: A8N162
LinkDB All DBs
Position
1
AA seq 530 aa AA seqDB search
MYPVDGVRSQLEWNSELSLNTVTPTETTKFLRKTSIIATIGPKVNTVEKLTELVRAGVNI
VRMNFSHGSYEYHQSVIDNTRAVQANDPKGRPIAIALDTKGPEIRTGVTKEGKDWPVSAG
QEFIVSTDERYAEACDSQVMYVDYANLPKVTAPGKLIYVDDGILSLLVLSVDGKNIHVRA
LNSGNISSRKGVNLPKTDVDLPALSEKDKKDLEFGVKNGVDMIFASFIRKAEDVQDIRTV
LGPDGANIKIIVKIENEQGVANFDEILKEADGVMVARGDLGIEIPASQVFLAQKMMIAKC
NIVGKPVIVATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPIQSVLM
MAETCLLAESSICYPPLFDDIRAIQPRPTATAETVAIAAVAAASEQGAKAILVLSTSGNT
ARLVSKYKPSVPIITVTRNQQTARQIHLHRGCYPFWYPEPRGIEAHQWQTDVDNRIRYGL
RNALALHLITPGSTVIAVQGWKGGLGHTNTLRVLSVPTDPADLELQPLGA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccgtcgatggcgtccgttctcagctcgagtggaactcggagctcagcctcaac
actgtcaccccaacagagacaacaaagttcttgcgcaagacctccatcatcgcgactatc
ggccccaaggtcaacactgtcgagaagcttactgagctcgtccgcgccggtgtcaacatc
gtgcgcatgaacttctcccatggttcctacgagtaccaccagagcgtcattgataacacc
agagccgtccaagcgaacgatcccaagggccgtcccatcgccatcgcccttgacaccaaa
ggaccagagatccgcactggcgtgaccaaggaggggaaggactggcccgtctccgccggc
caggaattcatcgtttcgacggatgaacggtacgccgaagcctgcgacagccaggttatg
tatgtcgactatgccaacctccccaaggtgaccgcacccggaaagttgatctatgtcgac
gacggtatcctctccctcctcgtcctctccgtcgatggcaagaacatccatgtccgcgcc
ttgaacagtggaaacatctcttcccgaaagggtgtcaacctccccaagaccgacgtcgac
ttgcctgctctctccgagaaggacaagaaggatcttgagtttggtgtcaagaatggcgtt
gacatgatctttgcctcgtttatccgcaaggctgaagacgtccaggacatccgaactgtc
ctcggtcctgacggtgccaacatcaagatcatcgtcaagattgagaacgagcagggtgtc
gccaactttgacgaaatcctcaaggaggctgatggtgtcatggtcgcccgtggtgacctt
ggtatcgaaatccctgccagccaggtcttccttgcccaaaagatgatgattgccaagtgc
aacattgtcggcaagcctgtcattgttgctactcagatgctcgagtccatgacgtacaac
cctcgacccactcgtgccgaagtcagcgatgttgccaacgctgtccttgatggtgctgac
tgcgtcatgttgtccggtgagaccgccaaaggcaactaccccatccaatcagtgttgatg
atggccgagacctgcctcctcgccgaatcctccatctgctaccctcccctcttcgacgac
atccgtgccatccaaccccgacccactgctaccgccgagaccgtcgctatcgctgctgtc
gccgctgccagtgagcagggtgccaaggccatccttgtcctctccaccagcggtaacact
gcccgcctggtatccaagtacaagccctctgtgcccatcatcaccgtcacccgcaaccaa
caaacggcaaggcaaatccacttgcaccgtggctgctatccattctggtaccccgagcct
cgcggcatcgaggctcaccaatggcagactgatgtcgacaaccgtatccggtatggtctc
cgcaacgccttggctctgcacctcatcacccccggttcaaccgtcatcgccgtgcaaggc
tggaaaggcggcttgggccacaccaacaccctccgtgtgctctccgttccgaccgaccct
gccgacctcgaactccaaccgttgggagcttag

DBGET integrated database retrieval system