KEGG   Coprinopsis cinerea: CC1G_11289Help
Entry
CC1G_11289        CDS       T01275                                 

Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cci  Coprinopsis cinerea
Pathway
cci03030  DNA replication
cci03410  Base excision repair
cci03420  Nucleotide excision repair
cci03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CC1G_11289
   03410 Base excision repair
    CC1G_11289
   03420 Nucleotide excision repair
    CC1G_11289
   03430 Mismatch repair
    CC1G_11289
Enzymes [BR:cci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CC1G_11289
    6.5.1.6  DNA ligase (ATP or NAD+)
     CC1G_11289
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CC1G_11289
DNA replication proteins [BR:cci03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CC1G_11289
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CC1G_11289
DNA repair and recombination proteins [BR:cci03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CC1G_11289
   NER (nucleotide excision repair)
    Other NER factors
     CC1G_11289
   MMR (mismatch exicision repair)
    Other MMR factors
     CC1G_11289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C ORC6
Motif
Other DBs
NCBI-GeneID: 6005130
NCBI-ProteinID: XP_001828699
UniProt: A8N1F0
LinkDB All DBs
Position
1
AA seq 803 aa AA seqDB search
MGRQQTLGKFFEMPKSMKPAPPQQSSLTEMWGKKRDVSTKSAPKKEEDAMEVDLKQEAQA
GPSKRKESALETKNSPKVKKRRIIESSDEEDEVASRASQSIATSSRHVTPEPSEAASSSP
VKKHVEGSRAVKPPHSDIDEESIAASEPEADEDRDDVLLEDDEELNPVGGTESKSARAAL
LKKDEVDIKGGWKVGQPVPYAALAKTFSLIEATTKRLEKNAILTAFLLLVIQRSAKDDHK
SLLQAVYLCINRLSPDYVGIELGIGESLLIKAIAESTGRSLAVIKADLKKEGDLGLVAMN
SKNSQKTLFKPKPLTLPFVFTQLKDIALTTGNASQAKKVALRANFALERRAICTGFSRTA
AVLAERERADKKWSQDKLTARLEEGAEIMKAVYSELPSYDSVVPALLEGGIKGLRERCKL
TPGIPLKPMLAKPTKAIGEVLDRFENKRFTCEYKYDGERAQIHRLDDGTVGVFSRNSEDM
SKKYPDLVDQLSKCIKKNTKSFVLDSEAVAIDRTTGKLMPFQELSRRKRKDVKVEDIQVR
VCIFAFDLLYLNGEPLINKPLVERRDLLRKHFQVVPGEFDFAKSSDGESTDEIQTFLEES
VKDGCEGLMVKMLESDASNYEPSRRSVNWLKLKKDYLAGVGDSLDLVVVGAYYGKGKRTN
YYGAFLLACYDADSEEYQTICKIGTGFSDEALQTHYETLKPLEQTKPRGDIKIGGAKPDI
WFEPKVVWEVLTADLSLSPIYTAAQGLVEERGISLRFPRFIRVRDDKDADDATAPEQIAE
MYERQSLAQAGSKKKGGDDDGFW
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccagcagactctcgggaaattctttgagatgcccaaatccatgaaaccagca
ccgccccaacagtcaagtttgacggagatgtggggcaagaaacgcgacgtgagcacgaag
agcgcgcccaagaaggaagaggacgcgatggaggtagatttgaaacaagaggcacaagct
ggaccgtctaagcgcaaggagagcgcgttagaaactaagaactccccaaaggtgaagaaa
cgaaggataattgagtcatcggatgaggaagatgaagtagcgagcagagcgagtcagtcg
attgcaaccagttccagacatgtcacacctgaaccttcggaagccgcatcctcctcccct
gtgaagaaacacgtcgagggctcacgtgcagtcaagccacctcatagtgacatcgacgag
gagtcaatagcagcaagcgaaccggaggcggacgaagatagggatgatgtgttactggag
gacgacgaggaactcaaccctgtgggaggtaccgaatctaaaagcgctcgcgcagcactc
ttgaagaaggatgaagtcgacatcaagggcggttggaaggtgggacaacctgtaccttat
gccgccctggccaagaccttctccctaatcgaggctacaacaaagcggctggagaagaat
gcaatcctcacggcattcttgctcctcgtcatccagaggagtgccaaggacgaccacaag
tcgctcctccaagctgtttatctgtgcatcaacagattgagccctgactatgtcggcatt
gaactaggtatcggcgagagcttgctcatcaaggccatcgctgaatccacgggtcggagt
cttgctgtcattaaggctgatcttaagaaggaaggagacctgggcttggtggccatgaat
tcaaagaatagccaaaagacgctgttcaaacctaaaccgcttactttacccttcgttttc
acgcaactcaaagatatcgcattgactactggtaatgcatctcaggcaaagaaagttgcc
ttgagggcaaacttcgcattggaacgcagagcgatctgtactggtttctctcgcactgct
gctgtcttggctgaacgagaacgagcggacaagaaatggagccaagataagctgactgcc
cgcctcgaggagggcgcagagatcatgaaggcagtttatagcgaattgccgtcctatgat
agtgtcgtccctgcacttcttgagggtggtatcaaagggttgagggaaagatgtaaactc
acccctggcatccctttgaagccgatgttggccaaacccacaaaggccattggcgaagtc
ttggatcgcttcgagaataagcgattcacttgtgaatacaaatatgacggagagcgagct
cagatccatcgtcttgatgatggcaccgttggtgtattcagtcgaaactctgaagatatg
agtaagaagtaccccgacttggtcgatcaactgtcaaagtgtatcaagaaaaacacgaaa
tccttcgtactggattctgaggcagtcgccatcgaccgcacgacaggcaaactcatgccc
ttccaagaactgagccggcggaaacgcaaagatgtcaaggtcgaggacatccaagtgcga
gtgtgcatattcgctttcgatttactgtacctgaacggcgagcccctcattaacaagcct
ctcgttgaacgtcgagaccttcttcgaaaacacttccaagttgtgcctggagagttcgac
tttgccaagtcctctgacggcgaaagtacagacgagattcagactttccttgaggaaagt
gtgaaggatgggtgtgaaggtttgatggtgaagatgttggaatctgacgcgagtaactat
gagcccagtcggcgcagtgttaactggctgaagctgaaaaaggattacctcgctggtgtg
ggtgactccctcgacctcgtcgttgtcggggcctactatggcaaaggcaaacgaaccaac
tattacggcgccttcctgcttgcctgctacgacgccgattcagaggagtatcagaccatt
tgcaagattggaaccgggtttagtgacgaggccttgcaaacccactatgagacactgaag
ccgcttgagcaaaccaaacctagaggagacatcaagattggaggtgccaagcctgacatt
tggtttgagccgaaggtagtctgggaagtgttaacggcggatctcagcttgtcccctatc
tatacggctgcacaaggattggtggaagaacgcggtatttcccttcgatttcctcggttc
atccgagtacgcgacgacaaggatgcggatgacgcaacggcgccggaacaaattgcagaa
atgtacgaacgacagagccttgcacaagctggttccaagaagaagggtggagacgacgac
ggattctggtga

DBGET integrated database retrieval system