KEGG   Coprinopsis cinerea: CC1G_11986Help
Entry
CC1G_11986        CDS       T01275                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cci  Coprinopsis cinerea
Pathway
cci00010  Glycolysis / Gluconeogenesis
cci00051  Fructose and mannose metabolism
cci00052  Galactose metabolism
cci00500  Starch and sucrose metabolism
cci00520  Amino sugar and nucleotide sugar metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
Module
cci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_11986
   00051 Fructose and mannose metabolism
    CC1G_11986
   00052 Galactose metabolism
    CC1G_11986
   00500 Starch and sucrose metabolism
    CC1G_11986
   00520 Amino sugar and nucleotide sugar metabolism
    CC1G_11986
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CC1G_11986
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CC1G_11986
Membrane trafficking [BR:cci04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CC1G_11986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 6014507
NCBI-ProteinID: XP_001837942
UniProt: A8P0Q1
LinkDB All DBs
Position
6
AA seq 499 aa AA seqDB search
MPLSRRGSGTFTLPSGQTLAQHTRTQDEEALPHATKRTMADHLRRFETLFTLTPQRMRII
VEAFKDALETGLEKHDQELPMIPTYVFGWPSGNERGEFVAIDLGGTNLRVCLLNLQGDGK
FEITQSKYRLSEEQKQDDGQKLFDFCAESLQTFIEGNSGEDGILQLAPGQKLPLGFTFSY
PCKQEKIDHGVLMRWTKGFVAPNTEGHDVAEMFRKSLEKYNLPVELKALINDTTGTLIAS
RYVNPSTKIACIFGTGCNAAYMERVKDIGKIKYLGIDDDVEMVINCEWGAFDSHNHEHLP
RTKYDISIDESSSKPGQQTFEKLISGRYLGEIVRLIICELIDEGVLFLGQNTYKLEVPWA
FDTALLSLMESDPTDELLMIIGIFSHFFALETTLAERQFLRAIARLVGRRAARLSACGIA
AIVSKMGYLDEGCSVGADGSLYNKYPGFAERIHEGLVDIFGERGRNIVTHHAEDGSGVGS
AIIAAMTKQRKDAGIYPDL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtcgcgtcgtggaagtggaacttttaccttgcccagcgggcagactctcgcc
cagcacacaaggacccaggatgaggaagccttgccccatgccactaagaggacaatggcc
gaccatctgcgaagattcgagacgctgtttactttgaccccccagcgaatgcggataatc
gtagaagcattcaaggatgctctggagactggattagagaaacatgatcaggaattgcct
atgatccccacgtatgtgttcggctggccgtctggaaacgagaggggagagtttgtggct
atcgaccttggcggcaccaatctccgcgtttgtcttctcaatctccagggagatggcaaa
ttcgaaatcacgcaatccaaatatcgactttccgaagaacagaaacaagacgacggccag
aagctcttcgatttctgtgctgaatccctgcaaaccttcatcgagggtaactcgggcgag
gatgggattttgcaactcgcaccgggacagaagctccccctcggatttacgttctcgtac
ccatgcaagcaggagaagatcgaccatggtgtactaatgcggtggacgaaaggcttcgtg
gctcccaacaccgaaggccacgatgttgcagagatgttccgaaagtctctggagaaatat
aatctcccagttgaactcaaagcgctcatcaacgacaccaccggtaccctcatcgcctcc
cgctacgtcaacccgtccacaaagatcgcatgcatctttggaacgggctgtaacgctgcg
tacatggaacgtgtgaaggacattggcaagatcaagtaccttggaatcgacgacgatgtt
gaaatggtaatcaactgtgaatggggagccttcgattcacacaatcatgaacacctgccc
cgaaccaagtacgacataagtatagacgaatcgtccagcaaaccaggccagcagacgttt
gagaaacttatttccggtcgttatcttggcgaaatagtccgccttatcatttgtgagctg
atagatgaaggcgtgttgttccttggacaaaacacatacaagcttgaagtcccttgggcg
tttgacactgccttgctttcccttatggaaagtgacccaaccgacgaactgctgatgatc
attggtattttctcccatttcttcgcgcttgagacgacgctcgcggagcgccagttcctg
agggcgattgcacgtttggtcggacgacgggccgcacgtttgagcgcctgcggaattgcc
gcaatcgtgagcaagatggggtacctagacgaaggctgttctgttggcgcagatggttcg
ttatacaacaaatatcctgggttcgccgagcgaattcacgagggccttgtcgatatcttt
ggcgagagaggaaggaacattgtcactcaccatgcagaggacggaagcggagtgggaagc
gctatcatcgccgccatgaccaagcaaagaaaggatgcgggaatataccccgatctctaa

DBGET integrated database retrieval system