KEGG   Corynebacterium camporealensis: UL81_02290Help
Entry
UL81_02290        CDS       T03923                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00620  Pyruvate metabolism
ccj00680  Methane metabolism
ccj01100  Metabolic pathways
ccj01120  Microbial metabolism in diverse environments
ccj01200  Carbon metabolism
Module
ccj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UL81_02290 (ppc)
  Energy metabolism
   00680 Methane metabolism
    UL81_02290 (ppc)
Enzymes [BR:ccj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     UL81_02290 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKE38439
UniProt: A0A0F6TAD5
LinkDB All DBs
Position
447307..449973
Genome map
AA seq 888 aa AA seqDB search
MSAAPDQVREDIRLLGRVLGRVIAQQEGEEVFELVESTRRMAFDVAHGDAQPEDLMAIFR
DLDITKTNLVARSFSYFALLANLAEDLDDESTDAPVSLRKTFAKLRDEGVSPADAAQVVR
GAHVAPVLTAHPTETRRRTVFDTQTRIKELLVEVHRGGNLEDIEREMYLRMTLLWQTALI
RIARPTLEDEVDVGLRYYKKSLLDQVPALNRAVRHGLRETFGLQLPDAPVVRPGSWIGGD
HDGNPYVNADTLGYATRQAAITVLSFYVDELGELERELSLSDRYSSCSTELLALADAAHN
DWESRVDEPYRRAIYGIRARMRATLARVEDPRSEASVEPYAAPEDFLRDLDVIDRSLRGN
NDDIIADDRLARIRSAVTTFGFHLYTLDLRQNSESFETVLTEIFRAAGLSENYAELSEDA
KVELLTSELSTPRPLLFPGAEEQFSEITTKELGIFRAAAAAVQEFGPRAISHCIVAMTGA
ASDLLEPMILLKEVGLQDMDIVPLFETIDDLQAGAGILDKLWALPLYREHLRRRGDIQEV
MLGYSDSNKDGGYLQANWALYDAELALVDLCTTHNIELRLSHGRGGAVGRGGGPTYDAIL
AQPKGAVSGSVRITEQGEVISAKYGAPETARRHLEAFVSGALEASLLDTEPIADPDRAYA
IMRELAAESGRRYAELIEDPGFIEYFTQSTPLHEIGDLNLGSRPAARKQTTAISDLRAIP
WVLSWSQSRTNIPGWFGVGSAVSRWVDAADNPDDRWAELQDLYTSWPFFRSVLSNMAQVM
AKAEINLARLYANLVDDPEIADRIYNLIASEFELTRDVYLRITGNKDLVSENQRQARSLR
RRYPYLLPLNAIQLELLRRYRGGDDQFLVSKTIQVTMNGLATALRNAG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagctgctccggatcaagttcgtgaagatatccgcctgctcggccgcgtgctgggt
cgggtcatcgctcagcaggaaggcgaagaagtctttgagctggtcgaatccacccgccgg
atggctttcgatgtagcccacggcgacgcccagcccgaagatctcatggcgattttccgc
gatctggacatcactaagaccaatctcgttgcgcgttcttttagttactttgcattgttg
gcaaatttggcggaggacctcgatgatgagtccactgacgccccggtgtcgctgcgcaag
acttttgccaagctgcgcgacgagggcgtctcgcctgccgatgccgcccaggtcgtccgc
ggcgcccatgtcgccccggtgctgaccgcccatcccaccgagacccgccgccgcaccgtc
ttcgacacccagacccgcatcaaggaactgcttgtcgaagtccaccgcggcggcaacctc
gaagacatcgaacgcgaaatgtacctgcgcatgaccctgctgtggcagaccgcgctcatt
cgcatcgcccgcccgaccctcgaagacgaggtcgatgtcggcctgcgttattacaaaaag
tccctgctcgaccaggttcctgccctcaaccgcgccgtccgccacggcctgcgtgaaacc
tttggcctgcagcttcccgatgctcccgtcgtcaggcccggctcctggatcggcggcgac
cacgatggcaacccttatgtcaacgctgacaccttgggctatgccacccgccaggccgcc
attacggtgctgagcttctacgtcgacgagctcggcgaattagagcgcgagctatcgctc
tccgaccgctattcttcctgctccacggagctgctcgcgcttgccgatgccgcccacaac
gactgggaatcccgcgtcgacgagccctaccgtcgcgccatctacggtatccgcgcccgc
atgcgcgcgaccctcgctcgcgtcgaggacccgcgctccgaggcatccgttgaaccctat
gctgctccggaggatttcctccgcgacctggatgtcatcgaccgctccctgcgcggcaac
aacgacgacatcatcgccgacgaccggctggcccgcatccgttctgctgtgacgaccttc
ggcttccacctctacaccctcgacctgcgccagaactccgaatctttcgaaaccgttctc
accgaaatcttccgcgccgcggggcttagcgagaactacgccgagctgtccgaagacgcc
aaagttgagctgctcaccagcgaactatccaccccacgcccgctgctgttcccaggcgct
gaggagcagttcagcgaaatcaccaccaaggagctcggcatcttccgtgccgccgcagcc
gccgtccaagaattcggcccgcgcgctatctcgcactgcatcgtcgccatgaccggtgcc
gcctccgacctgctcgagccgatgattctgctcaaggaagtcggcctgcaggacatggac
atcgtcccgctatttgagaccatcgacgatctccaggctggtgctggcatcctggacaag
ctctgggccctgccgctgtatcgcgaacatctgcgccgccgcggcgacatccaggaagtc
atgctcggctactccgattccaataaagacggaggctacctccaggcaaactgggcgctt
tacgatgccgaactcgccctcgtcgatctctgcaccacccacaacatcgaactgcgcctc
tcccacggtcgcggcggcgccgtcggccgcggcggcggccccacctacgacgccatcctc
gcccagcctaagggtgccgtcagcggctcggtccgcatcaccgaacaaggcgaagtcatc
tccgccaagtacggcgcccccgaaaccgcccgccgccacctcgaagccttcgtctccggc
gcactcgaggcatccctgctggataccgagcccatcgccgaccctgaccgcgcctatgcc
atcatgcgcgaactcgccgccgagtctggccgccgctacgccgaactcatcgaagacccc
ggttttatcgagtacttcacccagtccaccccgctgcacgaaatcggcgacctcaacctc
ggctcccgccccgcagcccgcaagcagaccaccgccatttccgacctgcgcgccatccct
tgggtgctgtcctggtcgcagtcgcgcaccaacatccccggctggttcggcgtcggatcc
gccgtctcccgctgggtcgacgccgccgacaaccccgacgaccgctgggccgaactccag
gatctctacacctcctggcccttcttccgctccgtgctctccaacatggctcaggtcatg
gccaaggccgaaatcaacctcgcccgcctgtatgccaacctcgtcgacgaccccgagatt
gccgatcgcatctacaacctcatcgccagcgaattcgagctcactcgcgacgtctacctg
cgcattaccggcaataaggacctcgtctccgaaaatcagcgccaggcccgctccctgcgc
cgtcgctacccctacctgctcccgctcaatgccatccagcttgagctgctgcgccgttac
cgcggcggcgacgaccaattcttggtctccaagaccatccaggtcaccatgaacggcctg
gccaccgccctgcgcaacgccggctaa

DBGET integrated database retrieval system