KEGG   Corynebacterium crudilactis: ccrud_12620Help
Entry
ccrud_12620       CDS       T04829                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00010  Glycolysis / Gluconeogenesis
ccjz00071  Fatty acid degradation
ccjz00350  Tyrosine metabolism
ccjz00625  Chloroalkane and chloroalkene degradation
ccjz00626  Naphthalene degradation
ccjz01100  Metabolic pathways
ccjz01110  Biosynthesis of secondary metabolites
ccjz01120  Microbial metabolism in diverse environments
ccjz01130  Biosynthesis of antibiotics
ccjz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ccrud_12620
  Lipid metabolism
   00071 Fatty acid degradation
    ccrud_12620
  Amino acid metabolism
   00350 Tyrosine metabolism
    ccrud_12620
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ccrud_12620
   00626 Naphthalene degradation
    ccrud_12620
Enzymes [BR:ccjz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ccrud_12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 2-Hacid_dh_C adh_short 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: ANE04956
UniProt: A0A172QWD2
LinkDB All DBs
Position
complement(2732772..2733809)
Genome map
AA seq 345 aa AA seqDB search
MTTTAPQEFTAAVVEKFGHEVTVKDIDMPKPGPNQALVKVLTSGICHTDLHALEGDWPVK
PEPPFVPGHEGVGEVVELGPGDHDVKVGDIVGNAWLWSACGTCEYCITGQETQCNEAEYG
GYTQNGSFGQYMLVDTRYAARIPDGVDYLEAAPILCAGVTVYKALKVSDTRPGQFMVISG
VGGLGHIAVQYAVAMGLRVIAVDISDDKLELARKHGAEFTVNARNEDPGEAVQKFTDGGA
HGVLVTAVHEAAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD
MAEALDFFARGLVKPTVSECSLDDVNDVLDRMRNGKIDGRVAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccactactgcaccccaagaatttaccgctgctgttgttgaaaagtttggtcatgag
gtgaccgtaaaggatatcgacatgccaaagccgggtccaaatcaggcgctggtgaaggtt
ctcacttctggcatttgccacactgacctccacgctttggagggcgattggccagtaaag
ccggaaccgccatttgtgccaggccatgaaggcgttggtgaagtcgttgaacttggtcca
ggagatcatgatgttaaggtcggcgatattgtcggcaacgcatggttgtggtcagcatgt
ggcacatgcgaatattgcatcaccggccaggaaactcagtgcaatgaggctgagtatggt
ggctacacccagaacggatcctttggtcagtatatgctggtagatacccgttatgcagca
cgcatcccggacggtgtggactacctggaagcggcaccaattctgtgtgctggtgtgact
gtatataaggcactcaaggtttcagatacgcgtccaggtcagttcatggtgatctccggt
gttggcggactgggacatattgcagtccagtacgcagttgcgatggggctgcgggtcatt
gccgtggatatctccgacgataaattggagcttgcacgtaaacacggcgcagaatttacc
gtgaatgctcgcaacgaagatccaggcgaagctgtgcaaaaattcactgatggtggcgct
catggtgtgctcgtaactgccgtgcacgaagctgcctttggtcaggctctggatatggct
cgtcgtgcaggcaccattgtgtttaatggtctgccaccaggggaattcccagcatctgtg
ttcaatattgtgttcaagggcctgacgattcgtggctctttggtgggtactcgccaagat
atggcagaggctcttgatttctttgctcgtggtttggtcaaaccaaccgtgagtgaatgt
tctttggatgatgtcaatgatgttcttgatcgcatgcgtaacggcaagattgatggacgt
gtagcgattcgttactag

DBGET integrated database retrieval system