KEGG   Capnocytophaga canimorsus: Ccan_20530Help
Entry
Ccan_20530        CDS       T01582                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00240  Pyrimidine metabolism
ccm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ccan_20530
Enzymes [BR:ccm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Ccan_20530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEK24169
UniProt: F9YU51
LinkDB All DBs
Position
2210593..2211312
Genome map
AA seq 239 aa AA seqDB search
MISKVFTNYIKNNKSLIYNTILSLLVKNPSEIQKNTYFCEQYNSIMFLENTTNYSEKFGW
IEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPAFDTRYDDVMVVSHNANEIRSTPVP
AAANIMLLADGCDVIGIDEAQFFDDEIVTVCNDLANRGMRVIVAGLDMDFKGKPFGPMPA
LMATAEYVTKVHAVCTRTGNLANFSYRKSANENVFLLGEQEAYEPLSRAAYFKAMKEKK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgattagcaaggtttttacgaattacatcaaaaacaacaaatcgctgatttacaacaca
atactctctttgttagtaaaaaatccgtcagaaattcaaaaaaatacttacttttgtgag
caatataacagcattatgtttttagaaaatactacaaattattcagaaaaatttggttgg
attgaggttatctgtggctctatgttttcaggaaaaacggaagagttgattcggcgttta
cgtcgggcacaatttgcgaaacagaaagtagagattttcaaacctgcctttgatactcgc
tatgatgatgtgatggtggtttcgcacaatgctaatgaaatccgctccacacccgttcct
gcagcagctaacattatgctcttggcagacggatgcgatgttattggcattgatgaagca
cagttttttgatgatgaaatcgttaccgtatgtaatgatttagcaaaccgagggatgcga
gttatcgttgctggtttggatatggatttcaaaggaaaacccttcggtccgatgcccgcc
ttaatggctactgctgagtatgttaccaaagtacacgcagtgtgtacccgcaccggaaat
ttagccaatttcagttaccgaaaatcggcaaacgaaaacgtttttcttcttggtgaacaa
gaagcctacgaacccctaagccgagccgcttacttcaaagcaatgaaagaaaagaaataa

DBGET integrated database retrieval system