KEGG   Corynebacterium callunae: H924_07495Help
Entry
H924_07495        CDS       T02507                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00620  Pyruvate metabolism
ccn00680  Methane metabolism
ccn01100  Metabolic pathways
ccn01120  Microbial metabolism in diverse environments
ccn01200  Carbon metabolism
Module
ccn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H924_07495
  Energy metabolism
   00680 Methane metabolism
    H924_07495
Enzymes [BR:ccn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     H924_07495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGG66941
UniProt: M1TRR3
LinkDB All DBs
Position
complement(1594895..1597654)
Genome map
AA seq 919 aa AA seqDB search
MNDLLRDDIRFLGRILGKVISEQEGSEVYELVERARQTSFQIAKGNLEMDTLVEVFKGID
PEKATPVARAFTHFALLANLAEDLHDAEAREQALDSGETPPESTLESTWLKLDEAEVKAS
DVSDVLRNAQVAPVLTAHPTETRRRTVFDAQKWITAYMQERQLLLAAPKNARTQAKLDAI
EKNIHRRISVLWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVVLELRSRYGK
VIPAKAVIKPGSWIGGDHDGNPYVTADVVAYSTSRAAETVLKYYGRQLHTLEHELSLSDR
MSSVTEELRELADAGKNDVPSRVDEPYRRAVHGIRGRILATTAHLIGEHAVEGTWFKIFE
PYSSPEEFAAELKIVDDSLRASHDELIADDRLAAIYAAVQSFGFNLYSLDLRQNSESYED
VLTELFQNAQVTADYRNLDEAAKTELLLKELRSPRPLIPNGGWDFTEPTERELGIFKMAA
HAVEKFGPNMVPHCIISMASSVTDVLEPMVLLKEFGLIKAKGDTPVGSIDVIPLFETIDD
LQAGAGILEDLWKIDLYRNYLQQRDNVQEVMLGYSDSNKDGGYFSANWALYDAELQLVDL
CRSAGVKLRLFHGRGGTVGRGGGPSYDAILAQPKGAVRGSLRITEQGEIISAKYGSPETA
RRNLEALVSATLEASLLDVSDLSDPERAYEIMREISELSLQKYSSLVHEDPGFIDYFTQS
TPLREIGSLNIGSRPSSRKQTSSVEDLRAIPWVLSWSQSRVMLPGWFGVGTALQQWIGSG
EQATERIKELQELNETWPFFTSVLDNMAQVMSKAELRLAKLYSELIPDREVAQRIYDVIF
DEYFLTKEMFCVITGSTDLLDENPLLARSVRSRFPYLLPLNVIQVEMMRRYRAGDESKGV
SRNIQLTMNGLATALRNSG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatcttttgcgagacgatatccgctttctcgggcgcatcctaggaaaggtaatt
tccgagcaagaaggctcggaagtttatgagttggttgagcgcgctcgccaaacctctttc
caaattgccaagggaaatctggaaatggacaccctagtagaggtgtttaagggaatcgac
cctgaaaaagctaccccagttgcccgcgcctttactcactttgcgctgctggctaacttg
gcagaggatctccatgatgcggaggctcgagagcaagctcttgattctggtgaaacccca
cctgagagcaccttggaatcaacctggctgaaattggatgaggcagaagttaaggcctcg
gatgtttccgatgtcttacgcaatgcccaggttgcgcctgttcttaccgcgcaccccacg
gaaactcgccgtcgcacagtttttgatgctcagaagtggatcactgcatatatgcaggaa
cgtcagctgcttttggctgctccaaaaaatgcacgtacccaggcaaagcttgatgcgatt
gaaaagaatattcatcgtcgtatctcggtgttgtggcagaccgcgttgattcgtgtggca
cgtcctcgcattgaagatgaaattgaggtgggcttgcgttattacaagctcagcttgttg
gaagaaatcccacgtattaaccgtgatgtggttttggaattgcgttcacgttatggcaag
gtcattccggcgaaggctgtaatcaagccaggttcctggattggtggagatcatgatggt
aatccatatgtcaccgcggacgtcgtggcttattccaccagccgcgctgcagagactgta
ctgaagtactatggccgccagctgcacactctcgaacatgagctgagcttgtctgaccgt
atgagctcggttactgaagaactgcgtgagctggccgacgctggcaaaaacgacgttcca
agccgcgtggatgagccttatcgtcgcgctgtacacggaattcgtggccgcatcctagca
accactgcacatctcattggtgagcatgccgtcgaaggcacctggtttaagatctttgag
ccatattcctcccctgaagaatttgccgccgaactaaaaattgtcgatgattctctccga
gcttctcacgatgagctcattgcagatgatcgtctagcggcaatttacgctgcggttcaa
agctttggctttaacctttattctttggacctgcgccaaaactccgagagctatgaggat
gtgctcactgagctcttccaaaacgcgcaggtcaccgcggattatcgcaacctcgacgag
gctgctaaaactgagcttttgctcaaggagctgcgcagcccgcgcccattgatccctaat
ggtggctgggatttcactgagcctaccgagcgtgagctgggcattttcaagatggcagcg
catgccgtcgagaagtttggccctaacatggtgcctcattgcattatttctatggcgtct
tcggtcactgacgttctcgagcccatggtattgctcaaggaatttggcctaatcaaggct
aagggcgatactccagtgggaagcatcgacgtgattccgctatttgaaaccatcgatgat
ctacaagctggcgccggaatcctcgaagatctctggaagattgatctttatcgcaactac
ctccagcagcgcgacaatgtccaggaagtcatgctcggctattccgattccaataaggat
ggcggatatttctcggcaaactgggcgctttacgacgcggaactgcagctggtagatctt
tgccgatcagccggggttaagttgcgcttattccacggtcgtggaggtacggttggccgt
ggcggcggaccttcctatgacgcaatcctggcacagcccaagggggctgtgcgcggatcg
ctgcgaatcaccgagcaaggtgaaattatttccgccaagtacggcagcccagaaacagct
cgtcgcaacttggaggcattggtttctgcaacgcttgaggcttccttgttggatgtttct
gatctttctgatccagaacgcgcctatgagattatgcgcgagatttctgagctcagcctg
cagaaatattcctctttggtgcatgaggatcctggcttcattgattacttcacccagtcc
acaccactgcgtgaaatcggctcactcaatattggttctcgaccatcgtctcgtaagcag
acatcttcggtggaagatttacgtgctattccttgggttctcagctggtcacaatctcgc
gtgatgttgccaggttggtttggtgttggcactgcgttgcagcaatggattggcagtggg
gaacaggccaccgagcgcattaaggagctgcaggagcttaatgagacttggccattcttc
acctctgtgctcgataacatggcacaggtgatgtccaaggctgaactacgcttagccaag
ctttattcggagcttattcctgatagggaagtagcccagcggatctatgatgtcattttt
gatgaatacttcctgactaaggaaatgttctgtgtcatcacgggatccactgatttgctg
gatgaaaatccgcttttggcgcgttcggtccgcagtcgattcccttatcttttgccactt
aacgtcattcaggtagagatgatgcgtcgctaccgcgcgggtgatgaaagcaagggagta
tcgcgcaatattcaattgactatgaatggcctggcaacggcactgcgaaactcaggttag

DBGET integrated database retrieval system