KEGG   Campylobacter concisus 13826: CCC13826_0112Help
Entry
CCC13826_0112     CDS       T00593                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
Organism
cco  Campylobacter concisus 13826
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1064086..1065126)
Genome map
AA seq 346 aa AA seqDB search
MNLGVIFGAKSFEHEISIVSAIVLKNVLKQGLKFIFCDANRDFYLIEQKDMRANFFSSGK
YKNSKKLSLAKGGFYTHSLFGANKVECDVIINLIHGMDGEDGKIAALFEFYGVKYIGPRL
EASALSYNKELTKFLAQKAGVKALDYEMLTRQSEPKFHYPIILKPARLGSSIGVSVVHDD
SELAYAKDVAFEFDKDVLVEPFIKGVKEYNLAGCRIDGKIKFSIVEEPKKKEFLDYEQKY
LSFSNENKVKEAEISEELKQKLKFNFSKIYDCGFDGAIIRCDFFVIDDEVYLNEINPNPG
SLANYLFEDFESTLNALANSLPKEREIKIDYKFINSITSVKGSGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaggcgtgatatttggggcaaagagttttgagcatgagataagcatagtaagt
gcgatagttttaaaaaacgtcctaaaacaggggttaaaatttatattttgcgatgcaaac
agggacttttacttgatcgagcaaaaagatatgagagcaaatttctttagctctggcaaa
tacaaaaactcaaagaagctatctttagcaaagggcggcttttacacgcactcacttttt
ggcgcaaacaaagttgaatgtgacgtcattataaatttgatccacggcatggacggcgaa
gatggcaagatagcggcactttttgaattttacggggtcaaatacataggtccaaggctt
gaagcaagcgcgcttagctacaacaaagagcttactaaatttctagcgcaaaaggctggt
gtaaaggcgcttgattacgagatgctaactcgtcaaagcgagccaaaatttcactatcct
attatattaaagccagcaaggctaggcagcagcatcggcgtgagcgtcgtgcatgatgat
agtgagcttgcctacgcaaaagacgtggcgtttgaatttgacaaagatgttttggtagag
ccctttataaaaggcgtcaaagagtacaaccttgcaggctgcaggatcgatggaaagatc
aaattttctatcgtcgaagagccaaaaaagaaagaatttcttgactatgagcaaaaatat
ctaagtttttcaaatgaaaataaggtaaaagaggcggaaatttctgaagagctaaagcaa
aagcttaaatttaacttttctaaaatttatgattgtggatttgacggagcgatcattaga
tgcgactttttcgtgatagatgacgaggtttatctaaacgagatcaatccaaacccaggc
agccttgcaaactatctatttgaggactttgagagcacactaaatgcccttgcaaactca
cttccaaaagagcgtgagataaagattgattataaatttataaactcgatcacttcggta
aaaggcagcggtaagctctag

DBGET integrated database retrieval system