KEGG   Chondrus crispus (carragheen): CHC_955Help
Entry
CHC_955           CDS       T02916                                 

Gene name
rbcS
Definition
(RefSeq) ribulose bisphosphate carboxylase, small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHC_955 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHC_955 (rbcS)
Enzymes [BR:ccp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CHC_955 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
PT
AA seq 138 aa AA seqDB search
MRLTQGAFSFLPDLTDEQIIKQIAYAISKNWSINIEHTEDPHPRNSYWELWGLPLFDIND
TATVMYEINSCRKQNPNVYIKINAFDNTRGIESCVLSFIIDRPAYEPGFELVRTEDVGRN
QRYCFRSYATFKPEGSRY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaacacaaggtgctttttcatttttaccagacttaactgatgagcaaattata
aaacaaattgcttatgcgatatctaaaaattggtcaattaatatagaacatacagaagat
ccacacccaagaaatagttactgggaattatggggtttaccattatttgatattaatgac
acagcaactgtaatgtatgaaattaatagttgccgtaaacagaatccaaatgtatatatt
aaaatcaatgcttttgacaatacgcgtggtattgaaagttgtgttctatcatttattatt
gacagacctgcttatgaaccaggttttgaattagtaagaaccgaagatgttggacgtaat
caaagatattgcttccgtagttatgcaacatttaaaccagaaggttctcgctactaa

DBGET integrated database retrieval system