KEGG   Chondrus crispus (carragheen): CHC_955Help
Entry
CHC_955           CDS       T02916                                 

Gene name
rbcS
Definition
(RefSeq) ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00630  Glyoxylate and dicarboxylate metabolism
ccp00710  Carbon fixation in photosynthetic organisms
ccp01100  Metabolic pathways
ccp01200  Carbon metabolism
Module
ccp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ccp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ccp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHC_955 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHC_955 (rbcS)
Enzymes [BR:ccp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CHC_955 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 14971107
NCBI-ProteinID: YP_007627453
UniProt: M5DD36
LinkDB All DBs
Position
PT
AA seq 138 aa AA seqDB search
MRLTQGAFSFLPDLTDEQIIKQIAYAISKNWSINIEHTEDPHPRNSYWELWGLPLFDIND
TATVMYEINSCRKQNPNVYIKINAFDNTRGIESCVLSFIIDRPAYEPGFELVRTEDVGRN
QRYCFRSYATFKPEGSRY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaacacaaggtgctttttcatttttaccagacttaactgatgagcaaattata
aaacaaattgcttatgcgatatctaaaaattggtcaattaatatagaacatacagaagat
ccacacccaagaaatagttactgggaattatggggtttaccattatttgatattaatgac
acagcaactgtaatgtatgaaattaatagttgccgtaaacagaatccaaatgtatatatt
aaaatcaatgcttttgacaatacgcgtggtattgaaagttgtgttctatcatttattatt
gacagacctgcttatgaaccaggttttgaattagtaagaaccgaagatgttggacgtaat
caaagatattgcttccgtagttatgcaacatttaaaccagaaggttctcgctactaa

DBGET integrated database retrieval system