KEGG   Chondromyces crocatus: CMC5_029550Help
Entry
CMC5_029550       CDS       T04010                                 

Definition
(GenBank) uncharacterized protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccro  Chondromyces crocatus
Brite
Enzymes [BR:ccro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CMC5_029550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AKT38809
UniProt: A0A0K1ED85
LinkDB All DBs
Position
3891478..3892053
Genome map
AA seq 191 aa AA seqDB search
MVRSLTARTTRVGLGLSAVLLVAVAPACGDEDGGSGGAGATGGTPARAATAEIAPLEDSG
VQGTAEFSVAGEEVTLSITIEGGGPGEHGLHIHQNGVCEGDGTSAGDHWNPEGHMHGHWN
EGEFHLGDIGNITLDAAGRGSLTLTTTRWSVGDGAPTDVVGHAVILHADPDDLASQPSGN
AGARIACGVIE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttccttgacggcgcggacgacgcgcgtgggtctcgggctctcggcggtgctg
ctggtcgcggtggctccggcctgcggtgacgaggacgggggcagcggtggcgcgggagcg
accgggggaacgccggcccgagccgccaccgccgagatcgctccgctcgaagacagcggg
gtgcagggtacggcggagttctcggtcgcgggcgaggaggtcacgctctcgatcaccatc
gagggcgggggacccggagagcatgggctgcacatccaccagaacggcgtgtgcgagggc
gatgggacctcggcgggagatcactggaaccccgaggggcacatgcatgggcactggaac
gagggcgagttccacctcggcgacatcggcaacatcaccctcgacgccgccgggcgcggg
agcctgacgctgaccacgacgcggtggagcgtgggcgatggggcgcccaccgacgtggtg
ggacacgccgtgatcctgcatgcggatcccgacgacctggcgagtcagccctcgggcaat
gccggggcgcggatcgcgtgcggcgtcatcgagtga

DBGET integrated database retrieval system