KEGG   Chondromyces crocatus: CMC5_062220Help
Entry
CMC5_062220       CDS       T04010                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccro  Chondromyces crocatus
Brite
Enzymes [BR:ccro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CMC5_062220
Peptidases [BR:ccro01002]
 Metallo Peptidases
  Family M2
   CMC5_062220
Exosome [BR:ccro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMC5_062220
CD molecules [BR:ccro04090]
 Proteins
  CMC5_062220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8470404..8472398)
Genome map
AA seq 664 aa AA seqDB search
MSRNVKNPTPSAHAGSRVLRGAVRACLAALGLTAIGMTSGCGGGAQGAAEAPSGAASPQA
VAAASATPAAPTVEEARAFFAEVDQELRRLWTDSSRAAWINQTYIIEDTDALSAAAESAS
MEFLNRVTKAATRFDGMKLPAELARQRTLLKVATTLPAPSDATKRAELAELLVTMGSDYG
KGKYCPAEGKTALGKYLVVKGKKGTEKKKCLTLPDLSDILRESRDWNEQLEAWTGWHAIA
PPLKKKYERYVELGNEGAREIGFSDLGALWRAGYDMTPAEFEAETDRLWGQVKPLYDELH
CYVRAQLRKRYGKDKVGEKAPLPAHALGNMWAQDWQGVYDAMVPFPGQPSLDVTKKLKDK
KIDEKEMVRIGERFFTSLGIDPLPATFWERSLFAKPEDREVVCHASAWDVGYRDDLRIKM
CIQPTEEDLITIHHELGHNYYYHYYYKLPILFQSGANDGFHEGIGDTLALSVTPEYLKSL
GLIDKVPGDEKGQVNFLFKQALSKVAFLPFGKLIDQWRWDVFSGKTKPADYNAAWWALRQ
KYQGVASPVARSEADFDPGAKYHVPAGVPYTRYFLAHIYQFQFHRALCAASGHKGPLHTC
SIHGSKAAGDKMKAMLAMGASRPWQEAMQALTGQSAADPGALLEYFEPLQRWLREQNKNE
TCGW
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgaaacgtgaagaatccaacgccttctgcccatgccgggagccgcgtcctgcgt
ggcgccgtgcgcgcctgcctcgctgccctggggttgacggccatcggcatgacgagcggg
tgtggaggtggggctcaaggcgccgccgaggctccgtccggggccgcctcgccgcaggcc
gtggccgcggcgtcggcgacgccggccgcgccgaccgtggaggaagcgcgggcgttcttc
gccgaggtcgaccaggagctccgtcgcctctggaccgactcgagccgcgcagcctggatc
aaccagacgtacatcatcgaggacaccgacgccctgtcggccgcggcagagagcgcctcg
atggagtttctcaaccgggtgaccaaggcagccacgcgcttcgatgggatgaagctgcct
gccgaactcgcgcgccagcggacgctgctcaaggtcgccaccacgctgccggcaccgagc
gacgcgaccaagcgcgccgagctggccgagctgctggtgacgatgggcagcgactacggc
aaggggaagtactgtccggccgaggggaagacggcgctcgggaagtacctggtcgtcaag
ggcaagaagggcacggagaagaagaagtgcctgacgctgccggacctgagcgacatcctg
cgcgagagccgtgactggaacgagcaactcgaggcgtggacgggctggcacgcaatcgct
cctccgctgaagaagaagtacgagcgctacgtcgagctgggcaacgagggggcgcgcgag
atcgggttctccgatctcggagcgctgtggcgtgctggctacgacatgacccccgcagag
ttcgaggcggagacggatcggctctggggtcaggtgaagccgctgtacgacgagctgcac
tgctacgtgcgcgcgcagctccgcaagcgctacggcaaggacaaggtcggtgagaaggcg
ccgctccccgcgcacgcgctggggaacatgtgggcgcaggactggcaaggcgtctacgac
gcgatggtgccgttccccgggcagccgtcgctcgacgtgacgaagaagctcaaggacaag
aagatcgacgagaaggagatggtgcggatcggtgagcggttcttcacctcgctcggcatc
gatcctttgcctgccaccttctgggagcgctcgctcttcgccaagccggaagaccgtgag
gtcgtgtgccacgcgagcgcgtgggacgtgggctaccgcgacgatctccgcatcaagatg
tgcatccagccgacggaggaggatctgatcacgatccaccacgagctggggcacaactac
tactaccactactattacaagctcccgatcctgttccagtcgggggccaacgacggcttc
cacgagggcatcggcgacacgctggcgctgtcggtgacgccggaatacctgaagtctctg
ggcctgatcgacaaggtccccggcgacgagaagggccaggtgaacttcctgttcaagcag
gcgctgagcaaggtcgccttcctgcccttcgggaagctcatcgatcagtggcgctgggat
gtgttctcggggaagacgaagcccgccgactacaacgcggcctggtgggcgctccgtcag
aagtaccagggcgtcgcgtcgccggtggcgcggagcgaggccgacttcgatcccggtgcg
aagtaccacgtgccggctggtgtgccgtacacgcgctacttcctggcgcacatctaccag
ttccagttccaccgagcgctctgcgccgcgtcggggcacaaggggccgctgcatacgtgc
tccatccacgggagcaaggcggctggtgacaagatgaaggccatgctggcgatgggcgcg
agccgtccctggcaggaggccatgcaggcgctcaccgggcagtctgctgccgatcccggg
gcgctgctcgagtacttcgagccgctccagcggtggctgcgagagcagaacaagaacgag
acgtgtggctggtag

DBGET integrated database retrieval system