KEGG   Cupriavidus sp. USMAHM13: BKK81_00500Help
Entry
BKK81_00500       CDS       T04762                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ccup  Cupriavidus sp. USMAHM13
Brite
Translation factors [BR:ccup03012]
 Eukaryotic Type
  Elongation factors
   BKK81_00500
 Prokaryotic Type
   BKK81_00500
Mitochondrial biogenesis [BR:ccup03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BKK81_00500
Exosome [BR:ccup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BKK81_00500
  Exosomal proteins of breast cancer cells
   BKK81_00500
  Exosomal proteins of colorectal cancer cells
   BKK81_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(88848..90038)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGAAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIID
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggactaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctggctgcgaagttc
ggcggtgccgccaagaagtacgacgaaatcgacgcagcgccggaagagaaggcacgcggt
attaccatcaataccgcccacgtcgagtacgagacggccaaccgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggttggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgagttccctggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgccctggacacc
tacatcccgacgccggagcgtgccgttgacggtaccttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtgatcaag
gtcggtgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtcggtctgctg
ctgcgcggcaccaagcgtgaagacgtggaacgcggccaagtgctgtgcaagccgggctcg
atcaagccgcacacccacttcaccggtgaggtgtacattctgtcgaaggacgaaggcggc
cgtcacaccccgttcttcaacaactaccgtccgcagttctacttccgtacgaccgacgtg
accggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggtctgcgcttcgctatccgt
gaaggcggccgtaccgtcggcgccggcgtcgtggcaaagatcatcgactaa

DBGET integrated database retrieval system