KEGG   Cupriavidus sp. USMAHM13: BKK81_15675Help
Entry
BKK81_15675       CDS       T04762                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BKK81_15675
Enzymes [BR:ccup01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BKK81_15675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:3555654..3556910
Genome map
AA seq 418 aa AA seqDB search
MTTLTREHCLALDRDDTLRHLREQFALPEGVIYLDGNSLGARPRAAAERAAAVVADEWGD
GLIRSWNSAGWFELPQRLGNKLAPLVGAGQDEVVVTDTTSINLFKVLAAALRVQASRDPA
RKVIVSESSNFPTDLYIAQGLADLLQQGYSLKLVDSPEQIEAALGADTAVLMVTHVNYKT
GEMLDMARLTALAHAKGALAVWDLCHSAGAVPVDLAAAGADYAIGCTYKYLNGGPGSPAF
VWVAPGLRDAFWQPLSGWWGHAAPFAMEPGYRPRSGVARYLCGTQPITSMALVECGLDIY
AQTDMQALRAKSLQLTDLFITLVETRCGHHPLELITPREHGRRGSQVSFAHPDGYAVMAN
LIDRGVIGDYREPRIARFGFTPLYTSFTEVWDAVEVLRDVLDSGSYRDARFQIRSTVT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattgacccgcgagcattgcctcgcactcgaccgtgacgacacgctgcgtcac
ctgcgcgagcagttcgcgctgcccgaaggcgtgatctacctcgacggcaactcgctcggc
gcgcgcccgcgcgcggcggccgaacgcgccgccgcggtggtggccgacgaatggggcgac
ggcctgatccgcagctggaacagcgccggctggttcgaactgccgcagcggctgggcaac
aagctggcgccgctggtcggtgccggccaggacgaggtggtggtgaccgacaccacctcg
atcaacctgttcaaggtgctggcggcggcgctgcgcgtgcaggcctcgcgcgatcccgcg
cgcaaggtgatcgtctccgagtcgagcaacttccccaccgatctctacatcgcccagggc
ctggccgacctgctgcagcagggctactcgctcaagctggtggactcgcccgagcagatc
gaggcggcgctcggcgccgacaccgccgtgctgatggtgacccacgtcaactacaagacc
ggcgagatgctggacatggcccggctgaccgcgctggcccatgccaagggcgcgctggcg
gtgtgggacctgtgccattcggccggcgcggtgccggtcgacctggccgcagccggggcc
gactacgccatcggctgcacctacaagtacctgaacggcggccccggctcgccggccttc
gtctgggtcgcgccggggctgcgcgatgccttctggcagccgctgtcgggctggtggggc
catgccgcgcccttcgccatggaacccggctatcgtccgcgttccggcgtggcgcgctac
ctgtgcggcacccagccgatcacctcgatggcgctggtggagtgcggcctggacatctac
gcgcagactgacatgcaggcgctgcgcgccaagtcgctgcaactgaccgacctgttcatt
acactggtggaaacgcgctgcggccaccacccgctcgaactcatcacgccgcgcgagcac
ggccgccgcggcagccaggtcagcttcgcccacccggatggctatgccgtgatggccaac
ctgatcgaccgcggcgtgatcggcgactatcgcgagccgcgcatcgcgcgcttcggcttc
accccgctctacaccagcttcaccgaggtgtgggacgcggtcgaggtgctgcgcgacgtg
ctcgacagcggcagctaccgcgacgcccgcttccagatccgcagcacggtgacctga

DBGET integrated database retrieval system