KEGG   Cupriavidus sp. USMAHM13: BKK81_22605Help
Entry
BKK81_22605       CDS       T04762                                 

Definition
(GenBank) hypothetical protein
Organism
ccup  Cupriavidus sp. USMAHM13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:944762..946816
Genome map
AA seq 684 aa AA seqDB search
MNWTILNSIRRNAEEEPGGLAFHFLHPEDGAGEPVTHGELAQSVARYAQGFRALAQPGGS
AQQKIVIALPQGPAFVAAFYGCIAAGAIAVPTFPPGNPLQADRIRHILQDLRECIVLAER
ECLDTALAPLRRDGELKGVHWCALSDLERMPAASLAGLSPDPAAIAMLQYTSGSTGRPKG
VMVSNRNLVENSALIQDCFNHRRGVSRSVIWLPPYHDMGLVGGVLQPTYAGFPALLMPTS
LLVRNPFRWLEAVTRFRGTSSGGPNFAFQLCVSHVRERDLRKLDLSSWNIAFCGAEPISH
RTMTEFSARFACAGFRPEAIYPCYGMAETTLMVSGKPHAESLRAVHVDARALARGIVREQ
DQAQGGTQSVVSCGRVHPSLDLRIVDPELGRERMAREIGEIWISGPSVAHGYLGRPEESE
KTFRQPLAGGTGRYLRTGDLGFIDQGELYVTGRMKELLIIRGANYYPQDIEQAAALAAPE
LVNGRFAAFPLTQDGAEVVAIAAECPRTLTHHNDVARRINAGLIARFGIKAEVILFVPRK
TIKVTSSGKLQRTAIRRDFLSGDLPVYHRSDDRREAAGPMPVEGAIAPGDGGWTVAGIQA
WIVARIGRITRSDPSRIRPDESFAELALDSVSSLEILSELDASHGIGVAPDSLYRHNTPE
LLAREIHRLWHLKQSSQGVSHGIA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacaattctgaactcgattcgacgtaatgccgaggaagagccgggaggactg
gcctttcacttcctgcatccggaggatggcgccggcgagccggtcacgcacggcgagctg
gcgcaaagcgtggcccgctatgcccaggggttccgggcactggcgcagccgggaggatcg
gcgcagcagaagatcgtgatcgcgttgccgcagggtccggccttcgttgcagccttctat
ggctgtatcgccgccggtgccatcgctgtgccgacctttccccctggcaatcccttgcag
gcggatcgcatccggcacatcttgcaggacctgcgcgaatgcatcgtgctggccgagcgt
gaatgcctggacacggcgctggcgccgctgcgccgggacggcgagctgaaaggcgtgcac
tggtgcgcgctgtccgatctcgaacggatgccggctgcgagcctggccggcctttcgccg
gacccggccgccatcgccatgctgcagtacacctccggctccacgggccggccaaagggg
gtgatggtcagcaaccggaacctggtcgagaactcggcgctgatccaggactgcttcaac
caccggcgtggcgtcagccgctcggtcatctggctgccgccataccacgacatgggcctg
gtgggcggggtgctgcaacctacctatgccgggttccccgcgctgctgatgccgaccagc
ctgctggtgcgcaatccattccgctggctggaggccgtcacccgcttccgcggaaccagc
agcggcgggcccaatttcgccttccagctttgtgtcagccatgtgcgcgagcgcgacctg
cgcaagctcgatctctccagctggaacatcgccttctgcggcgcggagccgatcagccat
cgcaccatgacggagttctccgcgcgcttcgcctgcgccgggttccgtccagaggccatc
tatccctgctacggcatggcggaaaccacgctgatggtctccggcaagcctcatgccgaa
tcgctgcgcgccgtgcacgtggatgccagggcgctggcgcgcggcatcgtccgtgagcaa
gaccaggcgcaaggcggcacgcagtcggtggtgagctgcggcagggtgcaccccagcctg
gacctgcgcatcgtcgaccccgaactcggccgtgagcgcatggcgcgggagatcggcgag
atctggatcagcggtccgagcgtggcgcatggctacctggggaggcccgaggagtccgag
aagacgttccggcagccgcttgcgggcggcacgggccgctacctgcgtaccggagacctg
ggattcatcgaccagggggagctgtatgtgaccgggcgcatgaaggaactgttgatcatc
cggggcgccaactactacccgcaggacatcgaacaggcggccgcgctggcggccccggaa
ctggtcaacggcaggtttgccgccttcccgctgacgcaggacggggccgaggtggtggcg
atcgcggccgaatgcccccgcacgctcacgcaccacaacgatgtcgcgcgtcgcatcaac
gcgggcctgatcgcccgcttcggcatcaaggccgaggtgatcctgttcgtgccgcgcaag
accatcaaggtcacttcttcgggaaagctgcagcgtacggcgatccgccgcgatttcctc
tccggcgacctgcccgtctatcaccgcagcgacgaccgtcgcgaggccgccgggccgatg
ccggtggagggggccatcgccccgggcgacggcggctggacggtggcgggcatccaggcc
tggatcgtcgcccgcatcggccgcatcactcgctcggacccgtcgcgaatccggccggac
gagagcttcgcggagctggcgctcgattcggtgtcctcgctggagatcctctctgaactc
gacgccagccacggcatcggggtggcaccggattcactctatcggcacaacacgccggag
ctgctcgcacgcgagatacatcgcctctggcatctgaagcaatcttcgcaaggagtctcc
catggcattgcctga

DBGET integrated database retrieval system