KEGG   Corvus cornix (hooded crow): 104687849Help
Entry
104687849         CDS       T03546                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104687849 (TGM2)
Cell adhesion molecules and their ligands [BR:ccw04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     104687849 (TGM2)
   VLA-5
     104687849 (TGM2)
   VLA-9
     104687849 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 611 aa AA seqDB search
MTDCPEESCWSAVIQQQDGESLSVSLCSPPNACIGRYSMTLETRTDYQGSSFQIGDFVLL
FNPWHPEDTVFMRDENERREYVLSQHGLIYQGTCDYIFSIPWNFGQFEDEILDICLNMLD
INPKHLRDQNRDCSRRNDPVYIGRVVSAMVNCNDEDRGVLFGRWDNRYEDGMSPMAWIGS
VDILKRWKKFGCQPVKYGQCWVFAAVACTVMRCLGVPSRVVTNYNSAHDTNANLTIDRYV
NEKGEQERSSWDKIWNFHCWVESWMARPDLAAGYDGWQALDPTPQEKSEGVYCCGPAPVK
AIKEGDMQLKYDIPFIFAEVNADVVYWVVQGDGMEKQSIRSSDVGKYISTKSVGRDSRED
ITHNYKYPEGSEEERAVFEKAEHQKKSIGEEDEGLHLRIKVSEGANKGSDFDVFAVVSNN
TDEERVCRVTLCARATSHNGTVGPLCGLTDPADIDIEPRAEKRVPLRILYEEYRDKLTQD
NLIKVVALLNDHQTGDILVAVRDIYVENPKIKIRILGEPMQNRKLVAEISLVNPLAVPLN
GCVFVVEGTGLTDGHFVKELEEPLEPQAEAKFRMDLMPRLSGLQKLMVDFESDQLTGVKS
YRNVIIAPQPM
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgactgactgcccggaggaatcgtgctggagcgccgtgatccagcagcaggacggggag
tccctttctgtctccctctgctccccacccaacgcctgcattggccgctacagcatgacc
ctggagacccgcactgactaccagggctccagcttccaaattggggactttgtcctgctc
ttcaacccctggcacccagaggacaccgttttcatgcgtgacgagaacgagcgacgtgag
tatgtcctgtcccagcacgggcttatctaccagggtacctgtgattacatcttctccatc
ccgtggaactttggccagttcgaggatgagatcttagacatctgcctcaacatgctggac
ataaaccccaaacacctgagggaccagaaccgggattgctcccgccgcaatgaccccgtg
tacattggcagggtggtgagcgccatggtaaactgtaatgacgaggaccggggggtgctg
tttgggcggtgggacaaccgctacgaggatgggatgagccccatggcctggattgggagt
gtggatattctcaagaggtggaagaaatttgggtgccagccagtcaagtatggccagtgc
tgggtctttgctgctgtggcgtgcacggtcatgcggtgcctgggagtccccagccgggtg
gtgaccaactacaactcagcccatgacacaaatgccaacctgaccattgaccgctacgtc
aacgagaagggggagcaggagagatcgtcctgggacaagatctggaacttccactgctgg
gtggagtcatggatggcccgtccagacctggcagctggctatgatgggtggcaggcgctg
gacccgacgccccaggagaagagtgaaggagtttactgctgcgggccagcccccgtcaaa
gccatcaaagagggtgacatgcagctcaagtacgacatccccttcatctttgcggaggtg
aacgccgacgtggtgtactgggtggtgcagggcgacgggatggagaagcagagcatccga
tcctcagatgtggggaagtacatcagcaccaagagcgtaggcagggacagccgggaggac
atcacccacaactacaaatacccggaggggtctgaggaggagcgggcggtgtttgagaag
gcagagcatcagaagaagtccatcggggaggaggatgaggggctgcacctcaggatcaag
gtgtcagagggtgcaaacaagggcagcgacttcgatgtctttgccgtcgtcagcaacaac
acagacgaggagcgtgtctgcagggtgacgctgtgcgcccgtgccaccagccacaacggc
accgtcgggcccctgtgcggcctcacggacccagctgacatcgacattgagcccagggca
gagaagagggtgcccctgcgcatcctgtacgaagagtacagggacaaactgacccaggac
aacctcatcaaggtggtggctctcctgaatgatcaccagacaggcgacatcctcgtggct
gtcagggatatttatgttgagaatccaaagatcaagatcaggattttaggagagccgatg
cagaatcggaagctggtggcagagatcagcctggtgaacccccttgcggtgcccctgaat
ggctgcgtgttcgtggtggagggcaccggcctcaccgacgggcactttgtcaaggagctt
gaggagccgctggagccgcaggcggaggccaaattccggatggatctgatgccgcggctg
tcagggctgcagaagctgatggtggactttgagagtgaccagctgacgggggtgaaaagc
taccgcaacgtcatcatcgcaccccagcccatgtga

DBGET integrated database retrieval system