KEGG   Corvus cornix (hooded crow): 104687868Help
Entry
104687868         CDS       T03546                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104687868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF2393 A2M_N DUF916
Motif
Other DBs
NCBI-GeneID: 104687868
NCBI-ProteinID: XP_019139817
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MAAATQPSTNWHLKENAREHHTSKFSSEELIVRRGQAFSITFNGTEKPEQNLIFLAETGP
KPSKATKTLATFGISSTVSKEGWSAVLQSTSSNSVSVSISSPHNAVIGRYKLSVQLGSSS
PASLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNKNRISSFGWNFGQFQGD
ILNICLSIMDRSLYYRQDPVTDVSHRHDPRYLGRVLSAMVNANDDLGVVLGNWSGKYEGG
KNPSSWTGSGEILQSWKKSGFKPVKYGQCWVFAAVLTTVLRCLGIPTRTITNFSSAHDAD
ENLRVDEFYDADGNHLERGADSIWNFHVWNESWFTRNDLGPSYSGWQVLDATPQEQSGGI
YQCGPASRYAIKEGEVDLDYDCPFVFAEVNADCMYWNYDSATGKKTLIFSTSTEIGVSIS
TKAVGRDDRVDVTSDYKYEEGSAKERDIFKKARKKLGLEDKFDPTAPTQEEIEQKPDISG
KFKVAGSLEVGKDLNLLLVLENLQSDAKTVNVNMTAWSTLYTRRPVNEIWKDSISVTLAP
KEEKQFPIKIKYPEYQQQLTTDKTIQVTALCHVEDGIQVLVQRNITLDNPAIDIQVLGEA
KVNEEVVVEVAFTNPTNTEVKDCVLQVEGNDLLRGILELRIPPLKASEKSSTKFKLIPSE
AGPKHLLVNFSCDKFADIKTFKMVNVIN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcaacgcagccaagtaccaactggcatctgaaagaaaatgcaagagaacac
cacacaagtaaattttctagtgaagaactgattgtgaggagaggacaggccttcagtatc
accttcaatggaacagaaaagcctgagcaaaatttaatattccttgcagaaacaggtcca
aaaccctcaaaggcaaccaagaccctggccacatttggtatctccagcacagtgagcaag
gagggctggagtgcagttctacagtccaccagttccaactctgtgagcgtctccatttcc
agcccgcataatgctgtcattggacgttacaagctgagtgttcaacttggcagctcctct
ccagcaagtcttggcacttttgttctgctttttaacccttggtcttcaggtgatgatgtg
ttcatgcctaacaaggctgagtgcgaggaatatgtgctagaagagtttggcataattttt
gcaggcaataaaaatcgtatcagcagctttggatggaactttggccagtttcaaggagat
atcctcaatatttgcctctccataatggatcgaagtttatactaccgtcaggatcctgtc
actgatgtatctcaccgacatgaccccaggtatctgggccgtgttctcagtgcaatggtc
aacgccaatgatgacctaggggtggtgctaggaaactggagtggaaaatatgagggtggt
aaaaatcccagcagttggacaggaagtggtgaaatcctgcaaagctggaagaaatcagga
ttcaaacctgttaaatatggacaatgttgggtttttgcagcagtattgactacagtgctt
agatgtctggggattcccactcgtacaattacaaacttcagttctgcccatgatgcagat
gaaaatctgcgtgtggatgaattttatgatgcagatggaaatcatttggagaggggagct
gacagcatatggaatttccacgtctggaatgaaagctggtttacacgcaacgacttgggc
ccctcatacagtggatggcaagttctggatgctactccccaagaacaaagtggaggaatt
tatcagtgtggtcctgcctcacggtatgccatcaaagaaggagaagtagatctggactat
gactgcccattcgtgtttgcagaagtgaatgcagactgtatgtactggaattatgactct
gcaactggaaagaaaactttaatattctctacatctacagaaattggtgtctccatcagt
acaaaggcagttggtagagatgatcgtgtagatgtcaccagtgattataaatatgaggaa
ggttctgcaaaagaaagagatatttttaaaaaagcccgtaagaagctaggacttgaggat
aaatttgatcctacagcaccgacacaagaggaaattgaacagaagcctgacatctcaggg
aaattcaaggtggctggctctttagaagttggcaaagatctcaacctacttctggttctt
gaaaatttacaatctgatgctaagactgtaaatgtaaatatgactgcatggagtactctg
tatactagaagaccagttaatgagatctggaaggactccatatctgtcactctggctcca
aaggaagaaaaacaatttcccattaagataaagtatcctgaataccagcagcagttaact
acagacaaaacaatccaggtcacagctttgtgtcatgtagaagatgggattcaagtgctc
gtgcaaagaaacatcaccctggacaatcctgccatcgacatacaggtacttggtgaagca
aaagtgaatgaagaggtggttgtggaagtggcatttaccaatcctaccaatacagaggtg
aaggactgtgtgctgcaggtggaaggcaatgacctgctccgaggaatcctggagttacgc
ataccaccactgaaagccagtgagaaatccagtaccaagtttaaacttatcccttctgag
gcgggtcccaaacatctacttgttaatttctcctgtgataaatttgcagatatcaagacc
tttaagatggtaaatgtgattaactaa

DBGET integrated database retrieval system