KEGG   Corvus cornix (hooded crow): 104688723Help
Entry
104688723         CDS       T03546                                 

Gene name
KMT5A
Definition
(RefSeq) N-lysine methyltransferase KMT5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104688723 (KMT5A)
Enzymes [BR:ccw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104688723 (KMT5A)
Chromosome [BR:ccw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104688723 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 274 aa AA seqDB search
MYHEVKCQGKTLKETYRKGAGKKNGGKTVEGAVKTEDQKDKEGGCNPSVPSSDQNQETVE
TQKTPLPADCAEEANAKPAQKKMVKAKRGPRKKTQGRTPNRKVTDYYPVRRSSRKSKSEL
ETEERRKIDELITSGKEEGMKIDYIDGKGRGVIATKHFNRGEFVVEYHGDLIEITDAKKR
EAVYAQDPSTGCYMYYFQYLSKTYCVDATKETNRLGRLINHSKCGNCQTKLHDIDGVPHL
ILIASRDIKAGEELLYDYGDRSKASIEAHPWLKH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgaggtgaaatgtcagggcaaaacgctaaaggaaacctacaggaaaggagct
ggaaaaaagaatggtggcaaaacagttgaaggtgctgtaaaaacagaagaccagaaggat
aaggaaggtgggtgcaatccttcggtgccctcctctgatcaaaaccaagaaactgtggaa
acccagaagactcccctgcctgcagactgtgctgaggaggccaatgcaaagccagctcag
aagaagatggttaaagcaaaacgaggaccaaggaaaaaaacgcaaggaagaacaccaaac
cgaaaagtgacagattattacccagttagaagaagttccaggaagagcaaatctgaattg
gagactgaggaaaggaggaaaatagatgagctgattacaagtgggaaagaagaaggaatg
aagattgattacatcgatggcaaagggagaggagtaattgctactaaacattttaatcga
ggagaatttgtggttgagtatcatggggatctcatcgagatcactgatgccaagaaacga
gaggctgtgtatgctcaagacccatccacaggctgctacatgtactatttccagtacctc
agcaaaacctactgtgtcgatgctacaaaagaaacgaatcgtctgggaaggctcattaat
cacagcaagtgtggcaattgtcagaccaagctccatgacatcgatggtgtgcctcatctc
atcctcatagcttccagggacattaaggcaggtgaagaactcttgtacgactatggagac
agaagcaaagcttccattgaagctcacccatggctgaaacactaa

DBGET integrated database retrieval system