KEGG   Corvus cornix (hooded crow): 104692390Help
Entry
104692390         CDS       T03546                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccw00001]
  Amino acid metabolism
   00310 Lysine degradation
    104692390 (KMT5B)
Enzymes [BR:ccw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104692390 (KMT5B)
Chromosome [BR:ccw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104692390 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 854 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHAQTKLQHAGKENPKTGKNGVERRSSRCSGASGFEG
QSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFK
KDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTCE
RRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKGNATNRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKPAK
PLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAVSS
GCLTRHAAREHKLNSVKGAHEHGDIAPCTYITRRSMRTRMSLKETSDTKLEPNTLDSYKS
NLTGTQSDIAEQQSRVLNDNNVAHGPSHKGEGRCQRNDAGTSKKKSRQGKLVKPSSKTEE
TDTMHNTPVKDEVPDLISSHSELEEKNHVVDTPVGFKDCIPGSGGCSLTTDNFKAKDSFR
TAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKLSKD
HEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREEENRGTYPEDLHENGVCCSETLSLLE
SRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSIDIDI
SSRRREDQSLRLNA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtagtgaatggccggagaagtggaagcaag
tcatctaatgaccacgcgcagaccaaattgcagcatgcaggaaaggagaatccaaagacg
ggcaaaaacggagttgagagaagatcaagcagatgtagcggtgcttcaggatttgagggt
caaagtcgttatgtgccttcctctggaatgtctgccaaggaactctgtgaaaatgatgac
ctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatgaatact
agatttcgacctattaaaggaaggcaagaagaactcaaagaggtgattgaacgttttaag
aaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcccggcac
tattttcttaacaagaacaaaatgcaggaaaggttattcaaggaacatgtatttatttat
ttacgaatgtttgcaactgacagtgggtttgagatactgccttgtaatcggtattcttct
gagcaaaacggagccaaaattgttgcaacgaaagaatggaaacgaaatgataaaatagaa
ttacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctgaggcat
ggggaaaatgacttcagtgtcatgtattccacacgaaaaaactgtgcacaactatggctt
ggtcctgctgcatttatcaatcatgattgcagacctaactgtaagtttgtatcaacgggc
agagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatctcctgt
tactacggagatgggttttttggagaaaataatgaatactgcgaatgttacacctgtgaa
agacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcctgtgatt
aacagtaaatatggactgagagaaacagacaaacgattgaacagacttaaaaagttgggt
gacagcagcaagaattccgacagccagtccgtcagctctaacactgatgcagataccact
caggaaaaaggtaatgcaactaacagaaaatcttcaattggcgtaaaaaagaacagcaaa
aatagaacattaaccagacagtctatatcaagaattccagcatcatcaaattctacctca
tctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcctgcaaag
cctttactttcaaagataaagttgagaaatcagtgcaaaaggccagagcaaaagaatgct
tctcgaaagcttgaaatgggaaatttagttctcaaagagcctaaagtagttttgtataaa
aacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtctctagc
ggatgcttaacgaggcatgcagcgagagaacataaactgaattctgtgaaaggtgctcat
gagcatggtgatattgcaccctgcacatacatcacgaggaggtcgatgagaacaaggatg
agtttgaaggagacctctgacacaaagcttgaaccaaatacgttggatagctataagagt
aacttgactggaacacaatcggacattgcagagcagcagtctcgtgtgttaaacgacaac
aatgtggctcatggaccatcacataaaggggagggtcggtgccagagaaatgatgcaggc
acatcaaaaaagaaatctcgacaaggaaagcttgtgaaaccatcttcaaaaacagaggaa
actgatactatgcacaacacgcctgtgaaagatgaagtaccagatttgattagttctcat
tcagaactcgaagagaaaaaccacgtggtggacacacctgttggctttaaagactgtatc
cctggatctggtggctgctctctaacaactgacaattttaaagcaaaagacagctttaga
actgcaaaaagtaaaaagaaaagacgaatcacaaggtatgatgcacaacttatccttgaa
aatagctctgggatccctaaactgactcttcgtaggcgccatgatagcagtagcaaggca
aatgatcaagagagtgatggaatgaattcttcaaaaataagcataaaattaagtaaagac
catgaaaaagataataatttatatgtagcaaagctaaataatgggtttaactcaggatca
ggcaatagttcaacaaaattaaaaatacagctaaaacgagaggaagaaaacagagggaca
taccctgaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcccttttggag
tcaagaatggaagtagatgattatggtcactatgaagaggaaacagcagatgaatcttca
tcagaagaggacgatgaagaggaagatgactatgatgatgaatttgatgactttattcct
cttcctccagcgaagagattaaggcttattgttggcaaggattcaatagatattgatatt
tcttccaggaggagagaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system