KEGG   Corvus cornix (hooded crow): 104696928Help
Entry
104696928         CDS       T03546                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X2
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     104696928 (TMPRSS9)
Peptidases [BR:ccw01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104696928 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1074 aa AA seqDB search
MDQIKPGQGTQRRRLGACCWKVTAAAAVAGSATALCLGILLACHSAGEASFEHTVELQGI
IFNSSLQMENSDYYRVLTPALERLFLSSLQESHLDWSCTGCTILGYRNGNSSVIVHFRLL
FTPQDSQPLSSTLEEEALRHGLAAALHKQGLSLAAYGTISSASLTGPNKVPPHRPGLKSD
CGSRPAMQTASRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQD
PAMWAAYTGTTSLRGSDSSAVKMDISQIIPHPSYNADTADYDVAVLELKRPVTFTKYIQP
VCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPEFLQKATVELLDQNLCSSLYSHALTDRM
MCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLRDW
ILDAISAFPTSIARTVPPVHFSTNMVSAEEVNTITGAAPTTSPAPAVSRPVTAARPQECG
GRPGFSKPSKIVGGTDASRGEIPWQVSLKEDSRHFCGATIIGDHWLLSAAHCFNETIPEE
IEAYVGTTSLNGTDENAVKVNVTRVILHPLFNPMILDFDVAVLELATPLVFNKYIQPVCL
PFAVQKFPVGKKCLISGWGDLQEGNDTKPEILQKASVGIIEQNTCNFLYNFSLTDRMICA
GFMEGMVDSCQGDSGGPLACEVTPGVFYLAGIVSWGFGCAQPMRPGVYSRITKFTDWILD
TISQLPNAGTSIPSSSAIPRTSTTAIFIQPSTMAASPASRTTLGKKMSTTASETSTALRT
TETAKPTQTPVVPCTSLTFKCSSKVCIGKENPECDGVVDCSNGFDERNCDCGLTTALAFS
KIVGGSSAARGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDIYGDPKMWVAFLGT
PFLSGIDGKMEKIFRIYKHPFYNVYSLDYDVALLELSTPVTFSSTIRPICLPDNSHIFHE
GTRCFITGWGSTKEGGLMSKHLQKAAVNMIGDQACKKFYPVQISSRMLCAGFPQGTVDSC
SGDAGGPLACKEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIAQNLKL
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggaccagataaagccagggcaaggtacccagagaaggagactgggggcctgctgctgg
aaggtaaccgctgctgctgctgtggcaggcagcgcaacagccctttgcctggggatcctg
ctggcctgccattctgctggagaggccagcttcgagcacacagtggagctgcaaggaatc
atattcaacagcagcttacagatggagaactcggactactatagggtgctgacacctgct
cttgagaggctgtttctgtccagtctccaagaatcccatctggactggagttgcaccggt
tgcaccatcctgggctacaggaacggaaactccagtgtgatcgtccatttccgcctcctc
ttcactccccaggattcccaacccctgagctctaccttggaggaagaagctctcaggcat
gggctggcggctgccctgcacaagcaggggctctccctggctgcctacgggaccatctcc
tcagcttctctcacaggtcccaacaaggttcctccccacagacctggactgaagtcagac
tgtgggagtcgccctgccatgcagactgccagcaggatagtcggaggctcagaggcgtcc
agaggagagttcccatggcaagtcagcctgcgagagaacaatgagcacttttgtggtgct
gcaatcctcacagagaagtggctggtgtctgccgctcactgctttactgagtttcaggac
ccagccatgtgggcagcttacacagggaccacctccctcagaggctctgacagcagtgca
gtgaaaatggacatttcacagatcatcccacacccctcttacaacgctgacacagctgac
tatgatgtggctgtgctggagctgaagagacctgtgaccttcactaagtacatccagcct
gtgtgcctgccagatgctggccatcacttccccaccagcaagaagtgccttatctctggc
tggggctacctcaaggaggatttcttggtgaaacccgagttcctgcagaaagcaacagtg
gagctcctggaccagaacctatgttccagtctctacagccatgctctcacagacagaatg
atgtgtgctggctacctggaggggaaagtcgactcctgccagggtgactctggtgggccc
ctggtttgccaagaaccatctggcaggtttttcctggcaggaattgtgagttggggtatt
ggatgtgctgaagccaggcggcctggagtttacacacgtgttaccaaactcagagactgg
atcttggatgctatttctgccttccctacctccatagcccgtactgtccctccagtacac
ttcagtactaacatggtcagcgctgaagaggtcaacaccatcaccggagcagcccctacc
acctcaccagccccagctgtcagcaggccagtgactgcagcaagaccacaagagtgtgga
ggacgacctgggttctctaaacccagcaagattgtgggaggaacagatgcttccagagga
gagatcccttggcaagtcagcctgaaagaagactcaagacatttctgcggagccaccatc
attggggaccactggctgctgtcagcagctcactgcttcaatgagacaattccagaagag
attgaagcctacgtgggaacaacatcactaaatggaacagacgagaatgcagtgaaagtc
aatgtaacaagagtgatcctgcatcccctcttcaaccccatgatcctggactttgatgtg
gctgtacttgaactggcaacacctcttgtcttcaacaaatacatacagcctgtgtgcctc
ccatttgctgtgcagaagtttcctgttggcaagaaatgcctcatttctggatggggtgac
ctccaggaagggaacgacaccaagcctgagatcctgcagaaagcatctgtgggcatcata
gaacagaacacctgcaacttcctctacaacttctccctcactgaccgaatgatctgtgct
ggcttcatggaggggatggtagactcgtgccagggagattcaggtgggcccttggcctgt
gaggtgaccccaggagtgttttaccttgctggcatcgtgagctggggatttggttgtgcc
cagcctatgagacctggtgtgtactccagaattacgaagttcacagactggatcctggac
accatctcccagttgcccaacgctggcacaagcatcccttccagttcagccattcctaga
acttctaccacagccatttttatccagcccagcacaatggctgcaagtccagccagcaga
accaccctgggaaaaaagatgagcacaaccgccagtgaaacctccacagctctgagaaca
accgagactgccaagcccacccaaactccagtggtgccttgtaccagcctcactttcaag
tgctccagcaaggtgtgtattggaaaagaaaatcctgaatgtgatggtgttgtggactgc
agcaatggcttcgacgagcgcaactgcgactgtggcttaacaactgctctggccttcagc
aagatcgtgggtggcagcagcgcggctcgaggagaatggccctggcaagtcagtctctgg
cttcggcggaaggagcacaagtgtggggctgtgctcattgctgaccggtggttgctctct
gcagctcactgctttgacatttacggtgaccccaaaatgtgggtggcctttctaggaaca
cccttcctgagtggcattgatggcaaaatggagaaaatattccgtatctacaaacaccct
ttttacaacgtctacagcctagactatgacgtggcactactggaactgagcacacctgtc
acgttcagcagcaccatcagacctatatgcctcccagacaattctcacatcttccatgaa
gggaccagatgcttcatcacaggctggggctccacaaaggaaggaggtctcatgtcaaag
catctgcaaaaagcagcagtgaacatgatcggagaccaggcctgcaaaaagttctaccct
gtccagatcagcagcaggatgctgtgtgctggtttcccacagggcactgtcgacagctgt
tcaggcgatgcaggtgggcccctggcatgtaaagaaccctcagggaagtggtttctagca
ggaatcacaagctggggctatggctgtgccaggccatacttccctggtgtctacaccaaa
gtcacagctgtccagggctggattgcgcagaacctcaagctctga

DBGET integrated database retrieval system