KEGG   Corallococcus coralloides: COCOR_03297Help
Entry
COCOR_03297       CDS       T01780                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ccx  Corallococcus coralloides
Brite
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCOR_03297 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4062699..4063283
Genome map
AA seq 194 aa AA seqDB search
MPFTLPELPYKKDALAPHMSQETLEFHHDKHHAAYVNKLNELTAGKPEASKSLEDVILSS
DGAVFNNAAQVWNHTFFWNCMKPAGGGKPTGDIAAAIDRDFGSYDEFKKQFTEAAITQFG
SGWAWLVKDGNKLAIMKTANADLPMKHGKKALLTVDVWEHAYYIDYRNLRAKFVEVFLNS
LVNWDFVNENLKNA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcacgctgcccgagctcccctacaagaaggacgcgctggcccctcacatgagc
caggagacgctggagttccaccacgacaagcaccacgcggcctacgtcaacaagctcaac
gagctgaccgcgggcaagcccgaggccagcaagtcgctggaggacgtcatcctcagcagc
gacggcgccgtgttcaacaacgcggcccaggtgtggaaccacacgttcttctggaactgc
atgaagccggccggcggtggcaagccgacgggtgacatcgcggccgccatcgaccgcgac
ttcggctcctacgacgagttcaagaagcagttcaccgaggccgccatcacgcagttcggc
tccggctgggcctggctggtgaaggacggcaacaagctggccatcatgaagacggccaac
gcggacctgccgatgaagcacggcaagaaggccctgctcaccgtcgacgtctgggagcac
gcctactacatcgactaccgcaacctgcgcgccaagttcgtcgaggtcttcctcaacagc
ctcgtgaactgggacttcgtgaacgagaacctgaagaacgcctga

DBGET integrated database retrieval system