KEGG   Corallococcus coralloides: COCOR_04528Help
Entry
COCOR_04528       CDS       T01780                                 

Gene name
pyk1
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_04528 (pyk1)
   01230 Biosynthesis of amino acids
    COCOR_04528 (pyk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_04528 (pyk1)
   00620 Pyruvate metabolism
    COCOR_04528 (pyk1)
  Nucleotide metabolism
   00230 Purine metabolism
    COCOR_04528 (pyk1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     COCOR_04528 (pyk1)
Exosome [BR:ccx04147]
 Exosomal proteins
  Proteins found in most exosomes
   COCOR_04528 (pyk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
5733905..5735305
Genome map
AA seq 466 aa AA seqDB search
MRKAKIICTLGPASDSKEVIEGLVKAGMNVARLNFSHGTHDEHRQRVQRIRAASKKLGVP
VAILQDVQGPKVRLGRFEGGQLMVTAGDTVTVTTRAVQGQGKIIPTPVRTLPRDVEKGHE
VLLDDGRVRLRVLKVSGQDVSCRVEVGGLLKDHKGLNLPGTAMSVPTLTEKDKVDLAFGQ
EVGVDYVALSFVRSAQDVRQARALVAKGKTPIISKIEKPQAVENLDAIARESDGVMVARG
DLGVEMPLEQLPAIQKRAVREVNRLGGIVIVATEMLESMVLNARPTRAEVSDVANAILDG
ADAVMLSGETAAGRYPVDAVATMARIVEETERTGLITLPHSPFERSEDLGTGVAAAAVAA
SRQLNIGTIIAYTESGHSARLISEFRPGARILGLTPNADTVNRMALYWGVTGHLVKRVSS
TEAMLKQVRRLCQELRFCEPGAPFILVAGVPLNVPGNTNMMSIHRI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggcgaagatcatctgcacgctgggtccggcttcggactccaaggaagtcatc
gagggactggtgaaggcgggcatgaacgtggcccggctcaacttctctcacgggacgcac
gacgagcaccgccagcgcgtccagcgcatccgcgcggcgtcgaagaagctgggcgtgccg
gtggccatcctccaggacgtgcagggccccaaggtgcgcctggggcgcttcgagggtggc
cagctgatggtgacggccggtgacacggtgacggtgacgacgcgcgcggtgcagggccag
gggaagatcatccccaccccggtgcgcacgctgccccgggacgtggagaagggccacgag
gtgctcctggacgacggcagggtgcgcctgcgcgtgctgaaggtgagcggccaggatgtg
tcctgccgcgtggaggtgggagggctcctcaaggaccacaaggggctcaacctgcccggc
acggccatgtcggtgcccacgctgacggagaaggacaaggtggacctggcgttcggccag
gaggtgggcgtggactacgtggcgctgtccttcgtgcgctccgcccaggacgtgcgccag
gcgcgggcgctggtggcgaagggcaagacgcccatcatctccaagattgaaaagccccag
gcggtggagaacctggacgccatcgccagggagtcggacggggtgatggtggcccgcggc
gatctgggcgtggagatgccgctggagcagctgcccgccatccagaagcgcgccgtgcgc
gaggtcaaccgcctgggcggcatcgtcatcgtcgccacggagatgctggagagcatggtg
ctcaacgcccggcccacgcgcgcggaggtgtcggacgtggccaacgccatcctcgacggc
gcggacgcggtgatgctctccggcgagacggccgcgggccgctaccccgtggacgcggtg
gccaccatggcgcgcatcgtggaggagacggagcgcaccggcctcatcaccctgccccac
tcccccttcgagcgctccgaggacctgggcaccggcgtcgccgcggcggcggtggccgcg
tcccggcagctcaacatcgggaccatcatcgcgtacacggagagcggccactccgcgcgg
ctcatctccgagttccgccccggcgcgcgcatcctcggcctgacgcccaacgcggacacg
gtgaaccggatggcgctgtactggggcgtgacgggccacctggtgaagcgcgtcagcagc
acggaggccatgctcaagcaggtgcgccggctctgtcaggagctgcgcttctgcgaaccc
ggcgcacccttcatcctggtggccggcgtgccgctcaacgtgccgggcaacaccaacatg
atgagcatccaccgcatctga

DBGET integrated database retrieval system