KEGG   Corallococcus coralloides: COCOR_04528Help
Entry
COCOR_04528       CDS       T01780                                 

Gene name
pyk1
Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_04528 (pyk1)
   00620 Pyruvate metabolism
    COCOR_04528 (pyk1)
  Nucleotide metabolism
   00230 Purine metabolism
    COCOR_04528 (pyk1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     COCOR_04528 (pyk1)
Exosome [BR:ccx04147]
 Exosomal proteins
  Proteins found in most exosomes
   COCOR_04528 (pyk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5733905..5735305
Genome map
AA seq 466 aa AA seqDB search
MRKAKIICTLGPASDSKEVIEGLVKAGMNVARLNFSHGTHDEHRQRVQRIRAASKKLGVP
VAILQDVQGPKVRLGRFEGGQLMVTAGDTVTVTTRAVQGQGKIIPTPVRTLPRDVEKGHE
VLLDDGRVRLRVLKVSGQDVSCRVEVGGLLKDHKGLNLPGTAMSVPTLTEKDKVDLAFGQ
EVGVDYVALSFVRSAQDVRQARALVAKGKTPIISKIEKPQAVENLDAIARESDGVMVARG
DLGVEMPLEQLPAIQKRAVREVNRLGGIVIVATEMLESMVLNARPTRAEVSDVANAILDG
ADAVMLSGETAAGRYPVDAVATMARIVEETERTGLITLPHSPFERSEDLGTGVAAAAVAA
SRQLNIGTIIAYTESGHSARLISEFRPGARILGLTPNADTVNRMALYWGVTGHLVKRVSS
TEAMLKQVRRLCQELRFCEPGAPFILVAGVPLNVPGNTNMMSIHRI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggcgaagatcatctgcacgctgggtccggcttcggactccaaggaagtcatc
gagggactggtgaaggcgggcatgaacgtggcccggctcaacttctctcacgggacgcac
gacgagcaccgccagcgcgtccagcgcatccgcgcggcgtcgaagaagctgggcgtgccg
gtggccatcctccaggacgtgcagggccccaaggtgcgcctggggcgcttcgagggtggc
cagctgatggtgacggccggtgacacggtgacggtgacgacgcgcgcggtgcagggccag
gggaagatcatccccaccccggtgcgcacgctgccccgggacgtggagaagggccacgag
gtgctcctggacgacggcagggtgcgcctgcgcgtgctgaaggtgagcggccaggatgtg
tcctgccgcgtggaggtgggagggctcctcaaggaccacaaggggctcaacctgcccggc
acggccatgtcggtgcccacgctgacggagaaggacaaggtggacctggcgttcggccag
gaggtgggcgtggactacgtggcgctgtccttcgtgcgctccgcccaggacgtgcgccag
gcgcgggcgctggtggcgaagggcaagacgcccatcatctccaagattgaaaagccccag
gcggtggagaacctggacgccatcgccagggagtcggacggggtgatggtggcccgcggc
gatctgggcgtggagatgccgctggagcagctgcccgccatccagaagcgcgccgtgcgc
gaggtcaaccgcctgggcggcatcgtcatcgtcgccacggagatgctggagagcatggtg
ctcaacgcccggcccacgcgcgcggaggtgtcggacgtggccaacgccatcctcgacggc
gcggacgcggtgatgctctccggcgagacggccgcgggccgctaccccgtggacgcggtg
gccaccatggcgcgcatcgtggaggagacggagcgcaccggcctcatcaccctgccccac
tcccccttcgagcgctccgaggacctgggcaccggcgtcgccgcggcggcggtggccgcg
tcccggcagctcaacatcgggaccatcatcgcgtacacggagagcggccactccgcgcgg
ctcatctccgagttccgccccggcgcgcgcatcctcggcctgacgcccaacgcggacacg
gtgaaccggatggcgctgtactggggcgtgacgggccacctggtgaagcgcgtcagcagc
acggaggccatgctcaagcaggtgcgccggctctgtcaggagctgcgcttctgcgaaccc
ggcgcacccttcatcctggtggccggcgtgccgctcaacgtgccgggcaacaccaacatg
atgagcatccaccgcatctga

DBGET integrated database retrieval system