KEGG   Corallococcus coralloides: COCOR_05092Help
Entry
COCOR_05092       CDS       T01780                                 

Gene name
fadD7
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6408400..6410151)
Genome map
AA seq 583 aa AA seqDB search
MLDIIQRLESVDPRRGLFLYDDFVAPSEFVPYREFASRVAGAAEHFRARGVAPGTRVVLP
FETSSSVIFSFLGLMELGAVPLSVKPYILSTPKGPYRDFLARIRERYGASVVLDVPGLAG
LELPLERLPLPPSGAKRPGAKLREVAPGELAFVQFSSGSTSFPKGVPITHENLAANLRMI
IRHDYRTVDERVTSWLPLYHDMGLIGGLLTCLAAGNDLLLSQPASFLMDPMGWLELISTE
RVAGSVIPNFAIDYALKSLKSADAEDLKRLDLSSVQGIYLGSEPINIPNLEQFLDILAPC
GLRRDVFMPCYGMAETVLIVASVARGQKVSVITAPNGQPAISVGRPLPEFEVRLRAEDGR
LCGEGELGEVELRGGSLAPSYFLDDRPLGGDDGFFATGDLGFQKEGELFITGRINDRIKV
NGQSFFSGDFEQAVERLGFIRPGRTAVIQAQGRIVVLAEVNHPSALERLEDSRKQVCQSV
LETVGVTLAPQDVLFIRYGQLQKTSSGKLQRRAITEAYEQGRIRTVTPRELRADLLQMRA
QRLVLGSVMVARQRGRRWMASGKAALSAGLLRFKPGGQRQDGP
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcatccagcggttggagtcagtggatccgcggcgcggcctgtttctctac
gacgacttcgtcgcgccgtcggagttcgtgccctaccgggagttcgcctcccgggtggca
ggggcggcggagcacttccgcgcgcgcggcgtggcgccgggcacgcgcgtggtgctgccc
ttcgaaacctcctcgtccgtcatcttctccttcctggggctgatggagctgggcgcggtg
cccctgtccgtgaagccgtacatcctgagcacgccgaagggaccctaccgggacttcctc
gcgcgcatccgtgagcgttacggcgcctcggtggtgctggacgtgcctggtctggccggg
ctggagctgcccctggagcggctgccgctgccgccctcgggcgcgaagcgtcccggtgcg
aagctgcgcgaggtggcgcccggggagctggcgttcgtgcagttctcgtcggggtccacg
tcgttccccaagggcgtgcccatcacccacgagaacctggccgcgaacctgcggatgatc
atccggcacgactaccgcacggtcgacgagcgggtgacgagctggctgccgctgtaccac
gacatggggctcatcggcgggctgctcacctgcctcgcggcgggcaatgacctgctgctg
tcccagcccgcgtcgttcctgatggaccccatgggctggctggagctcatctccaccgaa
cgggtggcgggctccgtcatccccaacttcgccatcgactacgcgctgaagtcgctcaag
tcggcggacgcggaagacctgaagcggttggacctgtcgagcgtccagggcatctacctg
ggcagcgagcccatcaacatccccaacctggagcagttcctggacatcctcgccccgtgc
ggcctgcggcgcgacgtgttcatgccctgctacggcatggcggagacggtgctgattgtc
gcgagcgtggcgcgaggccagaaggtgagcgtcatcaccgcgcccaacggccagccggcc
atctccgtgggccgccccctgccggagttcgaggtgcggctgcgcgcggaggatggacgg
ctgtgcggtgaaggtgagctgggggaggtcgagctgcgcggcggcagcctggcgccgtcg
tacttcctggacgaccggccccttggcggcgacgacggcttcttcgccacgggcgacctg
ggcttccagaaggagggcgagctcttcatcaccgggcggatcaacgaccgcatcaaggtg
aacggccagagcttcttctccggggacttcgagcaggccgtggagcggctgggcttcatc
cgcccgggccgcaccgccgtcatccaggcgcagggccgcatcgtggtgctggcggaggtg
aaccacccgtccgcgctggagcgcctggaggacagccgcaagcaggtctgccagtcggtg
ctggagacggtgggcgtgacgctcgcgccgcaagacgtcctcttcatccgctacggccag
cttcagaagacgagcagcggcaagctccagcgccgcgccatcaccgaggcctacgagcag
ggccgcatccgcacggtgacgcccagggagctgcgcgcggacctgctgcagatgcgcgcg
cagcggctcgtgctgggctcggtgatggtcgcgcggcagcggggccggcggtggatggcc
tccggaaaggcggcgctctccgcggggctcctgcggttcaagccggggggccagcgtcag
gacgggccctga

DBGET integrated database retrieval system