KEGG   Corallococcus coralloides: COCOR_06387Help
Entry
COCOR_06387       CDS       T01780                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccx  Corallococcus coralloides
Brite
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCOR_06387 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8045640..8046197
Genome map
AA seq 185 aa AA seqDB search
MTIRSLLVAAALLSTPALAQDAGTPAPTDAGTKPAIKKGETVKAMVKDAQGKDVGEVTME
QAPKGVLVRGTLANLPPGEHAFHIHETGKCEAPEFKTAGGHFNPTKKQHGALSPKGQHAG
DLPNLYVPQDGKVQFDVFIADLKVKSLLDKDGSAVMIHAKLDDYRTDPTGDAGGRIACGV
VEKAE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgttccctgctggttgccgccgccctcctctccacgcccgccctggcccag
gacgccgggacgccggcccccacggacgccgggacgaagcccgccatcaagaagggcgag
acggtgaaggcgatggtgaaggacgcccagggcaaggacgtgggcgaggtgacgatggag
caggcgcccaagggtgtgctggtgcggggcacgctggcgaacctgcccccgggtgagcac
gccttccacatccacgagacgggcaagtgcgaggcgccggagttcaagacggcgggcggc
cacttcaacccgacgaagaagcagcacggagcgctgtcgcccaagggccagcacgccggt
gacctgccgaacctctacgtcccccaggacggcaaggtgcagttcgacgtcttcatcgcc
gacctgaaggtgaagtcgctgctcgacaaggacggctccgccgtcatgatccacgccaag
ctggacgactaccgcaccgacccgaccggcgacgccggcggccgcatcgcctgcggcgtg
gtggagaaggcggagtag

DBGET integrated database retrieval system