KEGG   Corallococcus coralloides: COCOR_07206Help
Entry
COCOR_07206       CDS       T01780                                 

Gene name
fadD9
Definition
(GenBank) AMP-binding protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(9045670..9047427)
Genome map
AA seq 585 aa AA seqDB search
MKGPPLPALKHATVNAMLKATSHTSLGLVFVDAAEHETSLPWAQVYRRAKRAAAGLARLG
VRPGDRVALLLPTSPAFMDAYFGALMAGAVPVPLYPPVRLGRLDEYHRSTARMLQLTGSV
VVLTDTRVRLLLGPSMALARPKLGCHTVDAVLHGDEDLEVEVSPDALGLIQFSSGSTVEP
KPVALTHGALVAQVAALEAAMPVAPGVTPVGVSWLPLYHDMGLIGCVLSALYYPGSLVLI
PPETFLVKPALWLRALSRHRGFVSPAPNFAYGLCLKRVKDADLQGVDLSGWLHALNGAEP
VSADTLRRFAERFEKWGFSARALRPVYGLSEASLAVTFPPAGRGPRELGVDPDVLAREGQ
ARDGARTLVSVGAPVAGFEVQVRGEDGAVLPERQVGRVFAKGPSVMRGYFEDAEATSRAL
VEEGWLDTGDLGFSADGELYLTGRAKDLVIIRGANHAPQAFEDPLLKVDGVRTGCAVALG
FTPEGGQDEALLILAERAERGADVASVEADIRAAVVEATGVQPHTVRLLEPGTLPRTSSG
KLRRSEALRRYLAGELTAPKKVGAVGLAVEMAKSALAMVRAEHDS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggccgcccctgccggcgctgaagcacgccacggtgaacgcgatgctgaaggcg
acgtcgcacacgtcgctggggctggtgttcgtggacgccgccgagcacgagacgtccctg
ccatgggcccaggtctaccggagggcgaagcgcgcggcggcgggactggcgaggctgggt
gtgcgtccgggagaccgggtggcgctgctgttgcccacgtcgcccgcgttcatggatgcg
tacttcggcgcgctgatggcgggcgcggtgccggtgccgctgtacccgccggtgcggctg
gggcggctggacgagtaccaccgctcgacggcgcgcatgctccagctgacgggctcggtg
gtggtgctgacggacacgcgcgtgcggctgctcctgggcccgagcatggcgctggctcgg
ccgaagctgggctgtcacacggtggacgcggtgctgcacggcgacgaggacctggaggtg
gaggtgtcccccgacgcgctggggctcatccagttctcctccggctccacggtggagccg
aagccggtggcgctgacgcacggggcgctggtggcgcaggtggcggcgctggaggcggcg
atgccggtggctccgggcgtgacgccggtgggcgtgagctggttgccgctgtaccacgac
atggggctcatcggctgtgtgctctctgcgctgtactacccgggcagcctggtgctgatt
ccgccggagacgttcctggtgaagccggcgctgtggctgcgagcgctgtcgaggcaccgg
ggcttcgtgtcgcccgcgccgaacttcgcctatgggttgtgtttgaagcgggtgaaggac
gcggacctgcagggcgtggacctgtccgggtggctgcacgcgctcaacggcgcggagccg
gtgtccgcggacacgctgcgccgcttcgcggagcggttcgagaagtggggcttctccgcg
cgggcgctgcggccggtgtatggcttgtcggaggcgtcgctggcggtgacgttcccaccg
gcgggccggggcccacgcgagctgggcgtggatccggacgtgctggcgcgtgaagggcag
gcgcgtgacggggcacgcacgctggtgagcgtgggcgcgccggtggcgggcttcgaggtg
caggtgcgaggcgaggacggagcggtgttgccggagcgccaggtggggcgcgtgttcgcg
aaggggccgtcggtgatgcgcggctacttcgaggacgcggaggcgacgtcgcgggcgctg
gtggaggagggctggctggacacgggagacctgggcttcagcgcggacggggagctgtac
ctgacgggacgcgcgaaggacctggtcatcatccgaggcgcgaaccacgcgccgcaggcc
ttcgaggatccgctgctcaaggtggatggcgtgcgcacgggctgcgcggtggcgctgggc
ttcacgcccgagggcggccaggacgaggcgttgctcatcctggctgagcgcgcggagcgg
ggcgcggacgtggcgtcggtggaggcggacatccgcgccgcggtggtggaggccacgggg
gtgcagccgcacacggtgagactgctggagccggggacgctgccgcgcacgtccagcggc
aagctgcgaaggagtgaggcgctgcggcgatacctggccggagagctgacggcgccgaag
aaggtgggcgcggtggggctcgcggtggagatggcgaagagcgcactggcgatggtgcgc
gcggagcacgactcgtga

DBGET integrated database retrieval system