KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0543Help
Entry
DIP0543           CDS       T00151                                 

Definition
(GenBank) Putative sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DIP0543
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DIP0543
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     DIP0543
Bacterial toxins [BR:cdi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   DIP0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
512872..515037
Genome map
AA seq 721 aa AA seqDB search
MHSSNRTYSRAILGLSAALTLSFTSLVAPVNAEELETVVPAIAEQEGEAPATLPSAETGL
FDAAPPKPVARGAAGDLQLPAVNEEEVFEEGRVIRPPDENGKRCYRIPALITAKDGSLLL
AFDDRYGPDEKSKTWCRDAPYDPGKSSATIKQTDIALYRSVNDGKSFENYGFIAQGTKDS
RGLSYTDPALVVDRSSGKIFAFFVRGYDKRVAQAVSGYHSGNVEGPITNRNVQDTIVIES
EDNGRTWKNMKLISNLTDKVVVGGKTYTGRGRFVTSGSGVQLKFGLHAGRLIVPIAVDID
PSDSAKFVNLAIYSDDGGDTWEIGEGVAGVGYVSGDENKIIELSDGRLMMNSKEFKGGMR
WSSYSEDQGKTWSDPVDHLIAPPDHPNMYNAGINVGLIKAYPNAVKGSAASKVLLFSAPI
NRRNGSDYGVDGRENGWVMGSCDDGKTWSFGRQVEKNRFQYSSMTVMSDGSIGMVYESGT
REEGMNLKFAKFNMAWLGADCLSNEALGLTGDIDKEIVAAQEKAAAATKEAQEAAEKVEK
LTEELAAARKENDELKTQVKESEEAVGDLADKVFKLENAVTEAKKKATVAEKAVSDALAK
LQEAESIAEEQKAKAESAAAEAQALREKLEKLEGSILTAKENSEAEESADLSSTARDAAD
TARRAATDANGALSGQKQNEEKPAMGLMGILKVLAGIIPLVAIIATIFQTFRLPFNIPGM
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgcattcctcaaaccgaacctacagccgtgcaattctcggcctcagtgcagcattaaca
ctttcattcacatcgcttgtcgcgccagtgaatgcagaagagctcgaaactgttgtgcct
gctatcgcagaacaagaaggagaagcacctgcgacattgccgagcgctgaaactggactc
ttcgatgctgcgccaccaaagcctgttgcccgcggggcggctggagatctgcaattgccg
gcggtgaatgaagaagaagtttttgaggaggggcgagttattcgtccaccagatgagaat
ggaaaacggtgctaccgaattcctgctcttattacagctaaagacggtagccttcttctt
gcatttgacgatcgatatgggccggatgaaaaaagtaaaacatggtgccgagatgcgccg
tatgatcctggtaagtcttcagcaaccataaagcagactgatattgcgctttatcgatca
gttaacgatggtaaatcttttgaaaactatggttttattgctcaaggaactaaagatagc
cgtggtttgtcatatacagatccagcattggttgttgataggtcctcgggaaaaatcttc
gccttttttgtacgcggatatgataaacgcgtagcgcaagcagtgtcgggatatcacagc
ggtaatgttgaggggccaattaccaatcgaaatgtacaagatactattgttattgagtcg
gaagataacggccgtacatggaagaatatgaagctaatcagcaacttaacggacaaagtt
gttgttggtggtaagacatacaccggtaggggacgatttgtaacgtcaggttctggtgtg
caactaaaatttggactgcatgctggccggcttatagtgccgatcgctgtcgatatcgat
ccaagtgactcggcaaaatttgtaaacctagcaatttactctgatgacgggggcgatacg
tgggaaatcggtgaaggcgttgctggtgtcggatatgttagcggtgatgagaacaaaatc
atcgagctttctgatggtcgattgatgatgaattctaaagaatttaaaggcggaatgagg
tggtcatcgtattccgaagatcaagggaaaacatggtctgatccagtcgatcacctgatt
gcaccgcctgatcatcctaatatgtacaacgccggaattaacgtcggtttaattaaggca
tatcccaatgcggttaaagggagcgcagcgtcgaaagtattgcttttctcggcgccgatc
aatcgacgtaacggcagtgattatggtgttgatggtcgtgaaaacggctgggttatgggt
tcttgcgatgacggaaagacgtggtcctttgggcgtcaagttgaaaagaaccgttttcag
tattcaagcatgacggttatgtcggacggcagcatcggtatggtctacgaatcaggtacc
cgtgaagaaggaatgaacctgaaatttgccaagttcaacatggcatggctaggcgcagat
tgtctcagcaatgaggcattgggtttgacaggcgatattgataaggaaatcgtcgcggcg
caagaaaaggctgctgctgcgactaaagaagctcaagaagctgcggagaaggttgaaaag
ttaactgaagagttggctgctgctcgtaaagaaaatgacgagctcaagactcaggtaaag
gaatctgaggaagccgttggggatctagctgacaaggtatttaagctagagaacgccgtc
acggaagcaaaaaagaaagctactgtagctgaaaaggcagtatccgacgctctcgctaaa
ctgcaagaagctgagtcgattgcggaagagcaaaaggctaaagctgaatctgcagccgca
gaagctcaggcattgcgtgaaaagctggagaaacttgaaggaagcattcttactgcaaag
gagaattcagaagcagaagaaagcgctgatctatcaagtacagcgagggatgctgctgat
acagctcgtcgcgctgctacggatgcaaacggtgcactttctggtcaaaagcaaaatgaa
gaaaagccagctatgggcttgatgggaatcttgaaagtgcttgcggggatcattccactg
gtagcgatcattgcgactatattccaaacattccgtttgccttttaacattcctggaatg
aggtag

DBGET integrated database retrieval system