KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_00477Help
Entry
ERS451417_00477   CDS       T04861                                 

Gene name
nanH
Definition
(GenBank) sialidase-1
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdip00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ERS451417_00477 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ERS451417_00477 (nanH)
Enzymes [BR:cdip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ERS451417_00477 (nanH)
Bacterial toxins [BR:cdip02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ERS451417_00477 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:460568..462805
Genome map
AA seq 745 aa AA seqDB search
MSDGGCCSSLKGWPVYSSNRTYSRAILGLSAVLTLSFTSLVAPVNAEEPETVVPATAELE
GEVAATLPSAETGLFDAAPPKPVARGAAGDLQLPAVNEKEVFEEGRVIRAPEPDQSRCYR
IPALVTAKNGDLLLAFDNRYGGGDGAKTWCRDAPYENMKRINRQNMQTDIQLYRSVDNGQ
SFEDFGYIAQGTADVRELSYTDPALVTDRTTGKIFAFFVRAYDYRVGQSSAGFNEGDVEA
EIQKRDVQDTVVVESLDGGQTWGNMRLLSALTAKVSSISTGDTIFDGRGRFVTSGAGIQL
QYGEHAGRLIVPISVDIDPKDSAKFINLAIYSDDHGQTWQAGIGTAGGAGFSGDESKIVE
LSDGRLMMSSKDNDKPRWVSYSEDQGENWSTPKRKIIAPPQHPEKHNTGINVGLIRAYPN
APENSAAARVLLYSAPIDQRYSHKHTEDGRNNGWVMGSCDDGKTWSFGRQIEKNRFQYSS
MTVMSDGNIGMVYESGDFSTGMNLKFAKFNMAWLGADCLSNEALGLTGDIDKEIVEAQEK
AAEATKEAQEAAEKVQKLTEELAAARKENDELKNQVKGSKEAVGDLANEVEDLADKVFKL
ETAVTEAKEKATVAEKAASDAVTQLQKAESIAEEQKAKAESAAAEAQALREKLERLEGSI
LTVKENPEAEEIADLSSTAKDAADAARRAATDANGALSGQKQDEEKPAMGLMGILKVLAG
IIPLVAIIATIFQTFRLPFNIPGMR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatggtgggtgttgttcctccctgaaaggttggcctgtgtattcctcaaaccga
acctatagccgggcgattctcggcctcagtgcagtattaacactttcattcacatcgctt
gtcgcgccagtgaatgcagaagagcccgagactgttgtgcctgctaccgcagaactggaa
ggagaagtggctgcgacgttgccgagtgctgaaacagggctctttgatgcagcgccgcca
aagcctgttgcccgcggggcggctggagacctgcaattgccagcagtgaatgaaaaagaa
gtttttgaagaggggcgagtgatccgagctccggagcctgaccagagccgatgctatcga
attccggcgttggtaacagcgaagaatggtgatcttcttcttgcttttgataatcggtat
ggcggtggagatggcgctaagacttggtgtagggatgcgccctatgagaatatgaagcga
attaacaggcagaatatgcaaaccgatatacagttgtatcgctctgttgataatggacaa
tcttttgaagattttggatatatagctcaggggacagctgacgtaagggagttgtcctat
acggatcctgcattggttactgatagaacaactggaaaaatttttgctttctttgttcgg
gcgtacgactatcgtgtgggtcaatcttcggcaggttttaatgagggggacgttgaggcc
gagattcaaaaacgtgatgtgcaagatacggttgtggtggaatctttggatggggggcag
acttgggggaatatgcgtcttcttagtgcattaactgcaaaagttagtagcatttctacg
ggggatactatttttgatggacgcggtagattcgtaacatcgggtgcgggtattcagttg
caatatggggagcacgctggaaggttgatagttccgatatcggtggatattgatccgaag
gattcggccaagtttattaatctggccatctattccgatgatcatggacagacatggcag
gcaggtataggaactgctggtggagcaggattttcgggcgatgaaagtaaaatagtcgag
ttatctgatggtcgcttgatgatgagctcgaaagataatgataaacctcgctgggtctcc
tattctgaagaccaaggtgagaattggtctacgcctaagcgtaaaataattgcacctcca
cagcatccggaaaagcacaacacgggaataaatgtggggctgattcgggcttatcctaat
gctccggaaaatagtgccgcggcgcgagtactgctgtattccgctcctatagatcagcgt
tattctcataagcatactgaggatggtcgtaataatggctgggtcatgggatcttgtgat
gatggaaagacatggtcctttggtcgccaaattgaaaagaaccgtttccagtattcaagc
atgacagttatgtctgatggcaacatcggcatggtgtacgagagtggagactttagtacc
ggaatgaacctgaaatttgccaagttcaacatggcatggctaggtgcggattgtctcagc
aatgaggcgttgggtctgaccggcgatattgataaggaaattgtcgaggcgcaagaaaaa
gcagctgaagcaaccaaggaagctcaagaagctgcagagaaagttcaaaagctaactgaa
gagttggctgctgctcgtaaagaaaatgacgagctcaagaatcaggtaaagggatccaaa
gaagctgttggagatcttgcgaatgaggttgaggatctagctgacaaggtatttaagctg
gagaccgccgtcacggaagcaaaagagaaagctactgtggctgaaaaagcagcatccgac
gctgtcactcagctacaaaaagctgagtcgattgcggaagagcaaaaggctaaggctgaa
tctgcagccgcagaagctcaagcattgcgcgaaaagctggagagacttgaaggaagcatt
cttactgtcaaggagaatccagaagcagaagaaatcgcagacctttcaagcaccgcgaag
gatgctgctgatgcagctcgtcgcgctgctacggatgcaaacggtgcactttctggccaa
aagcaagatgaagaaaagcctgctatgggcttgatgggaatcttgaaagtgcttgcgggc
atcattccgctggtagcgatcattgcgactatattccaaacattccgtttgccttttaac
attcctggaatgaggtag

DBGET integrated database retrieval system